Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTP6UO8)

• DTT Name: Quinone oxidoreductase (CRYZ)
• Synonyms: Zeta-crystallin; NADPH:quinone reductase; CRYZ
• Gene Name: CRYZ
• DTT Type: Literature-reported target; [1]
• UniProt ID: QOR_HUMAN
• TTD ID: T83284
• EC Number: EC 1.6.5.5
• Sequence:
  MATGQKLMRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYS
  RKPLLPYTPGSDVAGVIEAVGDNASAFKKGDRVFTSSTISGGYAEYALAADHTVYKLPEK
  LDFKQGAAIGIPYFTAYRALIHSACVKAGESVLVHGASGGVGLAACQIARAYGLKILGTA
  GTEEGQKIVLQNGAHEVFNHREVNYIDKIKKYVGEKGIDIIIEMLANVNLSKDLSLLSHG
  GRVIVVGSRGTIEINPRDTMAKESSIIGVTLFSSTKEEFQQYAAALQAGMEIGWLKPVIG
  SQYPLEKVAEAHENIIHGSGATGKMILLL
• Function: Does not have alcohol dehydrogenase activity. Binds NADP and acts through a one-electron transfer process. Orthoquinones, such as 1,2-naphthoquinone or 9,10-phenanthrenequinone, are the best substrates (in vitro). May act in the detoxification of xenobiotics. Interacts with (AU)-rich elements (ARE) in the 3'-UTR of target mRNA species. Enhances the stability of mRNA coding for BCL2. NADPH binding interferes with mRNA binding.

The Drug-Metabolizing Enzyme (DME) Role of This DTT

• DTT DME Name: NADPH:quinone reductase (CRYZ) DME Info
• Gene Name: CRYZ

1 Approved Drug(s) Metabolized by This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Menadione	DMSJDTY	Vitamin K deficiency	5B59	Approved	[2]

5 Investigative Drug(s) Metabolized by This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
1,2-NAPHTHOQUINONE	DMYXELH	Discovery agent	N.A.	Investigative	[3]
4-hydroxy-2-nonenal	DM2LJFZ	Discovery agent	N.A.	Investigative	[4]
Acetyl ethylene	DMUH4N7	N. A.	N. A.	Investigative	[4]
Hexylacrolein	DMBC8KM	N. A.	N. A.	Investigative	[4]
J-009747	DMQSB6N	N. A.	N. A.	Investigative	[4]

References

• [1] NADPH/quinone oxidoreductase is a priority target of glioblastoma chemotherapy. Int J Oncol. 2000 Feb;16(2):295-303.
• [2] Role of glutathione reductase during menadione-induced NADPH oxidation in isolated rat hepatocytes. Biochem Pharmacol. 1987 Nov 15;36(22):3879-84.
• [3] Effect of superoxide dismutase on the autoxidation of various hydroquinones--a possible role of superoxide dismutase as a superoxide:semiquinone oxidoreductase. Free Radic Biol Med. 1988;5(2):71-9.
• [4] Kinetic and structural evidence of the alkenal/one reductase specificity of human crystallin. Cell Mol Life Sci. 2011 Mar;68(6):1065-77.