Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTPCG5T)

• DTT Name: Hepcidin (HAMP)
• Synonyms: Putative liver tumor regressor; PLTR; Liverexpressed antimicrobial peptide 1; LEAP1; Hepcidin20; Hepc25; Hepc20; HAMP
• Gene Name: HAMP
• DTT Type: Clinical trial target; [1]
• BioChemical Class: Hepcidin family
• UniProt ID: HEPC_HUMAN
• TTD ID: T22995
• Sequence:
  MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRD
  THFPICIFCCGCCHRSKCGMCCKT
• Function: Has strong antimicrobial activity against E.coli ML35P N.cinereaand weaker against S.epidermidis, S.aureus and group b streptococcus bacteria. Active against the fungus C.albicans. No activity against P.aeruginosa (PubMed:11113131, PubMed:11034317).
• KEGG Pathway: TGF-beta signaling pathway (hsa04350)

Molecular Interaction Atlas (MIA) of This DTT

5 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
LJPC-401	DMVM13R	Beta thalassemia	3A50.2	Phase 2	[2]
NOX-H94	DM5HPZU	Anemia	3A00-3A9Z	Phase 2	[1]
PTG-300	DMOYS8A	Hemochromatosis	5C64.1Y	Phase 2	[3]
Hepcidin mab	DMBFYSR	Anemia	3A00-3A9Z	Phase 1	[4]
LY2787106	DM9NYHT	Anemia	3A00-3A9Z	Phase 1	[5]

1 Preclinical Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
12B9m	DM5IUN8	Anaemia	3A90	Preclinical	[6]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Shwachman-Diamond syndrome	3B64	Bone marrow	5.37E-01	0.18	0.47

References

• [1] The effects of the anti-hepcidin Spiegelmer NOX-H94 on inflammation-induced anemia in cynomolgus monkeys. Blood. 2013 Mar 21;121(12):2311-5.
• [2] ClinicalTrials.gov (NCT03395704) A Study of LJPC-401 for the Treatment of Iron Overload in Adult Patients With Hereditary Hemochromatosis. U.S. National Institutes of Health.
• [3] Clinical pipeline report, company report or official report of Protagonist Therapeutics.
• [4] The pathophysiology and pharmacology of hepcidin. Trends Pharmacol Sci. 2014 March; 35(3): 155-161.
• [5] A first-in-human phase 1 study of a hepcidin monoclonal antibody, LY2787106, in cancer-associated anemia. J Hematol Oncol. 2017 Mar 21;10(1):73.
• [6] Pharmacokinetics of anti-hepcidin monoclonal antibody Ab 12B9m and hepcidin in cynomolgus monkeys. AAPS J. 2010 Dec;12(4):646-57.