General Information of Drug Therapeutic Target (DTT) (ID: TTQW87Y)

DTT Name Opioid receptor kappa (OPRK1)
Synonyms OPRK; Kappa-type opioid receptor; Kappa opioid receptor; KOR-1; KOR; K-OR-1
Gene Name OPRK1
DTT Type
Successful target
[1]
BioChemical Class
GPCR rhodopsin
UniProt ID
OPRK_HUMAN
TTD ID
T60693
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLEPAHISPAIPV
IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYL
MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI
CIWLLSSSVGISAIVLGGTKVREDVDVIECSLQFPDDDYSWWDLFMKICVFIFAFVIPVL
IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEALG
STSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPLKMRMERQSTSRV
RNTVQDPAYLRDIDGMNKPV
Function
Functions as receptor for various synthetic opioids and for the psychoactive diterpene salvinorin A. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling leads to the inhibition of adenylate cyclase activity. Inhibits neurotransmitter release by reducing calcium ion currents and increasing potassium ion conductance. Plays a role in the perception of pain. Plays a role in mediating reduced physical activity upon treatment with synthetic opioids. Plays a role in the regulation of salivation in response to synthetic opioids. May play a role in arousal and regulation of autonomic and neuroendocrine functions. G-protein coupled opioid receptor that functions as receptor for endogenous alpha-neoendorphins and dynorphins, but has low affinity for beta-endorphins.
KEGG Pathway
Neuroactive ligand-receptor interaction (hsa04080 )
Reactome Pathway
G alpha (i) signalling events (R-HSA-418594 )
Peptide ligand-binding receptors (R-HSA-375276 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
5 Approved Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
CHLOROXINE DMFZBMQ Erythema ME64.0 Approved [2]
Dezocine DMJDB0Y Pain MG30-MG3Z Approved [1]
Difelikefalin DMHZBEO Pruritus EC90 Approved [3]
Nalbuphine DMOSQGU Pain MG30-MG3Z Approved [4]
Nalfurafine hcl DMA9DHW Uremic pruritus EC90.10 Approved [5]
------------------------------------------------------------------------------------
18 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Asimadoline DMND3AB Diarrhea-predominant irritable bowel syndrome DD91.01 Phase 3 [6]
JNJ 67953964 DMJ8Y5N Major depressive disorder 6A70.3 Phase 3 [7]
CR-845 DMJYTUQ Pain MG30-MG3Z Phase 2/3 [8]
PHN-131 DM1SV8I Pain MG30-MG3Z Phase 2/3 [9]
A277 DMIYY96 Chronic pain MG30 Phase 2 [10]
Apadoline DM1B8IT Pain MG30-MG3Z Phase 2 [11]
BTRX-335140 DMWPDUZ Major depressive disorder 6A70.3 Phase 2 [12]
Carfentanil DM7ADGX N. A. N. A. Phase 2 [13]
CR-665 DMNC1AF Pain MG30-MG3Z Phase 2 [14]
Enadoline DMGFZOL Pain MG30-MG3Z Phase 2 [15]
LY-2456302 DMLTSDC Alcohol dependence 6C40.2 Phase 2 [16]
Niravoline DM81SDB Pain MG30-MG3Z Phase 2 [17]
ORP-101 DMSH20P Irritable bowel syndrome DD91.0 Phase 2 [18]
AIKO-150 DMW9ZFS Opioid dependence 6C43.2Z Phase 1 [19]
BRL-52656 DM1V9YG Pain MG30-MG3Z Phase 1 [20]
MCP-201 DMW9YOJ Pain MG30-MG3Z Phase 1 [21]
PF-4455242 DMYR7XP Bipolar disorder 6A60 Phase 1 [22]
SALVINORIN A DMJ3HQY Cerebral vasospasm BA85.Z Phase 1 [23]
------------------------------------------------------------------------------------
⏷ Show the Full List of 18 Clinical Trial Drug(s)
11 Discontinued Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
CLIOQUINOL DM746BZ N. A. N. A. Withdrawn from market [2]
ADL 10-0101 DMPFQLX Pain MG30-MG3Z Discontinued in Phase 2 [24]
Dynorphin a DMT2WVP N. A. N. A. Discontinued in Phase 2 [25]
E-2078 DMHEW40 Pain MG30-MG3Z Discontinued in Phase 2 [26]
R-84760 DM4O7KA Pain MG30-MG3Z Discontinued in Phase 2 [27]
VP004 DMXK8FQ Substance use disorder 6C4Z Discontinued in Phase 1 [28]
Fedotozine DMJX1IB N. A. N. A. Terminated [31]
GR-89696 DMTGH8N Neurodegenerative disorder 8A20-8A23 Terminated [32]
GR-94839 DM96KF7 Pain MG30-MG3Z Terminated [33]
KT-95 DM8VMJ3 Inflammatory bowel disease DD72 Terminated [34]
SB-213698 DM58PKG N. A. N. A. Terminated [35]
------------------------------------------------------------------------------------
⏷ Show the Full List of 11 Discontinued Drug(s)
2 Preclinical Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
GNTI DMTJRLU Obesity 5B81 Preclinical [29]
LY-25582 DM2N637 Obesity 5B81 Preclinical [30]
------------------------------------------------------------------------------------
247 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
(-)-cyclorphan DMC8WS4 Discovery agent N.A. Investigative [36]
1-(1,2-diphenylethyl)-4-phenylpiperidin-4-ol DMOR9EK Discovery agent N.A. Investigative [37]
1-(2-ethoxy-1-phenylethyl)-4-phenylpiperidin-4-ol DMV3FSH Discovery agent N.A. Investigative [37]
1-(dio-tolylmethyl)-4-phenylpiperidin-4-ol DMLYO8P Discovery agent N.A. Investigative [37]
1-benzhydryl-4-(2-fluorophenyl)piperidin-4-ol DMTANPG Discovery agent N.A. Investigative [38]
1-benzhydryl-4-(2-methoxyphenyl)piperidin-4-ol DMWHMNY Discovery agent N.A. Investigative [38]
1-benzhydryl-4-(3-fluorophenyl)piperidin-4-ol DMXZFPB Discovery agent N.A. Investigative [38]
1-benzhydryl-4-(3-methoxyphenyl)piperidin-4-ol DM1QYS8 Discovery agent N.A. Investigative [38]
1-benzhydryl-4-(3-phenylpropyl)piperidin-4-ol DMIT7SH Discovery agent N.A. Investigative [38]
1-benzhydryl-4-(4-bromophenyl)piperidin-4-ol DM0BQYX Discovery agent N.A. Investigative [38]
1-benzhydryl-4-(4-chlorophenyl)piperidin-4-ol DMWYG8K Discovery agent N.A. Investigative [38]
1-benzhydryl-4-(4-ethylphenyl)piperidin-4-ol DME0BJD Discovery agent N.A. Investigative [38]
1-benzhydryl-4-(4-fluorophenyl)piperidin-4-ol DMRNZD6 Discovery agent N.A. Investigative [38]
1-benzhydryl-4-(4-methoxyphenyl)piperidin-4-ol DMXT894 Discovery agent N.A. Investigative [38]
1-benzhydryl-4-(4-propylphenyl)piperidin-4-ol DMJDUM5 Discovery agent N.A. Investigative [38]
1-benzhydryl-4-(benzyloxy)-4-phenylpiperidine DMDRUBL Discovery agent N.A. Investigative [37]
1-benzhydryl-4-(furan-2-yl)piperidin-4-ol DMMB2GV Discovery agent N.A. Investigative [38]
1-benzhydryl-4-(pyridin-2-yl)piperidin-4-ol DMJ8F60 Discovery agent N.A. Investigative [38]
1-benzhydryl-4-(thiophen-2-yl)piperidin-4-ol DMNOZR2 Discovery agent N.A. Investigative [38]
1-benzhydryl-4-benzylpiperidin-4-ol DMVBR36 Discovery agent N.A. Investigative [38]
1-benzhydryl-4-butylpiperidin-4-ol DMRN7SC Discovery agent N.A. Investigative [38]
1-benzhydryl-4-cyclohexylpiperidin-4-ol DMZVSYD Discovery agent N.A. Investigative [38]
1-benzhydryl-4-ethoxy-4-phenylpiperidine DM6PIL2 Discovery agent N.A. Investigative [37]
1-benzhydryl-4-hexylpiperidin-4-ol DMUK95S Discovery agent N.A. Investigative [38]
1-benzhydryl-4-isopropylpiperidin-4-ol DMGYCQ3 Discovery agent N.A. Investigative [38]
1-benzhydryl-4-m-tolylpiperidin-4-ol DMVJH1S Discovery agent N.A. Investigative [38]
1-benzhydryl-4-methoxy-4-phenylpiperidine DMBG0N8 Discovery agent N.A. Investigative [37]
1-benzhydryl-4-o-tolylpiperidin-4-ol DMVUMSF Discovery agent N.A. Investigative [38]
1-benzhydryl-4-p-tolylpiperidin-4-ol DM679RC Discovery agent N.A. Investigative [38]
1-benzhydryl-4-phenyl-4-propoxypiperidine DMEB968 Discovery agent N.A. Investigative [37]
1-benzhydryl-4-phenylpiperidin-4-ol DM7KU1X Discovery agent N.A. Investigative [39]
1-benzhydryl-4-tert-butylpiperidin-4-ol DMM5DTF Discovery agent N.A. Investigative [38]
12-EPI-SALVINORIN A DMZ9PW3 Discovery agent N.A. Investigative [40]
14-O-phenylpropylnaltrexone DMI7LXH Discovery agent N.A. Investigative [41]
17-(Cyclobutylmethyl)-N-phenylmorphinan-3-amine DMUQWPZ Discovery agent N.A. Investigative [42]
17-(Cyclopropylmethyl)-N-phenylmorphinan-3-amine DM174HN Discovery agent N.A. Investigative [42]
17-methyl-4'-methyldihydromorphinone DMMEB64 Discovery agent N.A. Investigative [43]
17-Methylmorphinan-3-yl 4-Iodophenyl Carbamate DMI4WCQ Discovery agent N.A. Investigative [42]
2-(2-methylquinolin-4-ylamino)-N-phenylacetamide DMW75IF Discovery agent N.A. Investigative [44]
2-Benzylaminomethyl-3-hydroxymorphinan DM6EMGJ Discovery agent N.A. Investigative [42]
2-EPI-2-THIOSALVINORIN A DM2PDGO Discovery agent N.A. Investigative [45]
2-EPI-2-THIOSALVINORIN B DMZXIW0 Discovery agent N.A. Investigative [45]
2-Hydroxymethyl-3-hydroxymorphinan DM4LMPD Discovery agent N.A. Investigative [42]
2-THIOSALVINORIN B DMIEGF4 Discovery agent N.A. Investigative [45]
3-(1-benzylpiperidin-4-yl)-5-chloro-1H-indole DM2YKHI Discovery agent N.A. Investigative [46]
3-(1-benzylpiperidin-4-yloxy)benzamide DMG3A4Z Discovery agent N.A. Investigative [47]
3-desoxy-3-carboxamidonaltrexone DMBNA0V Discovery agent N.A. Investigative [48]
3-Methylfentanyl DMX71N9 Discovery agent N.A. Investigative [49]
3-Methylthiofentanyl DMC153X Discovery agent N.A. Investigative [50]
4-(4-((phenethylamino)methyl)phenoxy)benzamide DM0QRJ3 Discovery agent N.A. Investigative [51]
4-(p-Tolyl)spiro[chromene-2,4'-piperidine] DMIOQJD Discovery agent N.A. Investigative [52]
4-(Spiro[chromene-2,4'-piperidine]-4-yl)benzamide DM0XDG6 Discovery agent N.A. Investigative [53]
4-(Spiro[chromene-2,4'-piperidine]-4-yl)phenol DM8ZRAE Discovery agent N.A. Investigative [52]
4-phenyl-1-(1-phenylbutyl)piperidin-4-ol DMVCIJB Discovery agent N.A. Investigative [37]
4-phenyl-1-(1-phenylethyl)piperidin-4-ol DM6EFLV Discovery agent N.A. Investigative [37]
4-phenyl-1-(1-phenylheptyl)piperidin-4-ol DMISTXQ Discovery agent N.A. Investigative [37]
4-phenyl-1-(1-phenylhexyl)piperidin-4-ol DM1GRWY Discovery agent N.A. Investigative [37]
4-phenyl-1-(1-phenylpentyl)piperidin-4-ol DMZQ7DP Discovery agent N.A. Investigative [37]
4-phenyl-1-(1-phenylpropyl)piperidin-4-ol DMALIQ8 Discovery agent N.A. Investigative [37]
4-phenyl-1-(phenyl(m-tolyl)methyl)piperidin-4-ol DMFV0JC Discovery agent N.A. Investigative [37]
4-phenyl-1-(phenyl(o-tolyl)methyl)piperidin-4-ol DM2MPWC Discovery agent N.A. Investigative [37]
4-phenyl-1-(phenyl(p-tolyl)methyl)piperidin-4-ol DM5R6T4 Discovery agent N.A. Investigative [37]
4-phenyl-4-[1H-imidazol-2-yl]-piperidine DMPY4G1 Discovery agent N.A. Investigative [54]
4-Phenylspiro[chromene-2,4'-piperidine] DMW46K7 Discovery agent N.A. Investigative [52]
5-(4-((phenethylamino)methyl)phenoxy)picolinamide DMZYE8W Discovery agent N.A. Investigative [51]
6-(4-((benzylamino)methyl)phenoxy)nicotinamide DMEM1BA Discovery agent N.A. Investigative [51]
6-(4-((phenethylamino)methyl)phenoxy)nicotinamide DM9VD4W Discovery agent N.A. Investigative [55]
6-(4-(2-(benzylamino)ethyl)phenoxy)nicotinamide DMDKOWP Discovery agent N.A. Investigative [55]
6-(4-(3-(benzylamino)propyl)phenoxy)nicotinamide DMDTMB7 Discovery agent N.A. Investigative [51]
6-(Allyl-methyl-amino)-4,4-diphenyl-heptan-3-ol DMYMJHF Discovery agent N.A. Investigative [56]
6-desoxonaltrexone DMGZQNS Discovery agent N.A. Investigative [48]
6beta-naltrexol HCl DMZ8PBE Discovery agent N.A. Investigative [57]
8-azabicyclo[3.2.1]octan-3-yloxy-benzamide DMQMSZR Discovery agent N.A. Investigative [58]
8-carboxamidocyclazocine DMD18V5 Discovery agent N.A. Investigative [59]
ANISOCOUMARIN H DMHA9S3 Discovery agent N.A. Investigative [60]
Benzyl derivative of M6G DMX8W4G Discovery agent N.A. Investigative [61]
Beta-endorphin DM7XC6B Discovery agent N.A. Investigative [62]
Bis-((-)-N-propargylmorphinan-3-yl) sebacoylate DM0WKNI Discovery agent N.A. Investigative [36]
BRL 52537 hydrochloride DM16GUV Discovery agent N.A. Investigative [63]
BRL 52974 DM6XO72 Discovery agent N.A. Investigative [64]
BUTORPHAN DM82KPQ Discovery agent N.A. Investigative [65]
Cis-H-Tyr-c[D-AllylGly-Gly-Phe-D-Allylgly]-OH DMQUB19 Discovery agent N.A. Investigative [66]
Clocinnamox DMZLMJH Discovery agent N.A. Investigative [41]
CYCLAZOCINE DMC6DAZ Discovery agent N.A. Investigative [65]
CYCLORPHAN DMB1U8V Discovery agent N.A. Investigative [65]
C[L-Ala-D-pro-L-Phe-D-trp] DMHXTWK Discovery agent N.A. Investigative [67]
C[L-mTyr-D-pro-L-Phe-D-trp] DMNHSR0 Discovery agent N.A. Investigative [67]
C[L-Phe-D-pro-L-mTyr-D-trp] DM82ZOM Discovery agent N.A. Investigative [67]
C[L-Phe-D-pro-L-Phe-D-trp] DM0NTU5 Discovery agent N.A. Investigative [67]
C[L-Phe-D-pro-L-Phe-L-trp] DMCY4L0 Discovery agent N.A. Investigative [67]
C[L-Phe-D-pro-L-Tyr(OMe)-D-trp] DM4M3OP Discovery agent N.A. Investigative [67]
C[L-Phe-D-pro-L-Tyr-D-trp] DMADSBT Discovery agent N.A. Investigative [67]
C[L-Tyr(OMe)-D-pro-L-Phe-D-trp] DMLB6UA Discovery agent N.A. Investigative [67]
C[L-Tyr-D-pro-L-Phe-D-trp] DM7OIY8 Discovery agent N.A. Investigative [67]
DAMGO DMS1DVA Discovery agent N.A. Investigative [68]
Dcp-c[D-Cys-Gly-Phe(pNO2)-D-Cys]NH2 DMU287Q Discovery agent N.A. Investigative [69]
DEOXY SALVINORIN A DM5JFKX Discovery agent N.A. Investigative [70]
Deprotected cogener of M6G DMH340E Discovery agent N.A. Investigative [61]
Dhp-c[D-Cys-Gly-Phe(pNO2)-D-Cys]NH2 DMSN87T Discovery agent N.A. Investigative [69]
Dihydromorphine DM4TR0D Discovery agent N.A. Investigative [71]
Dimepheptanol DMRMHE8 Discovery agent N.A. Investigative [56]
Diprenorphine DMIXPU6 Discovery agent N.A. Investigative [72]
DM6S DMAJ0Q8 Discovery agent N.A. Investigative [68]
Dmt-Pro-3,5Dmp-Phe-NH2 DM5WEFK Discovery agent N.A. Investigative [73]
Dmt-Pro-Dmp-Phe-NH2 DMGUIR1 Discovery agent N.A. Investigative [73]
Dmt-Pro-Dmt-Phe-NH2 DM4VEU2 Discovery agent N.A. Investigative [73]
Dmt-Pro-Emp-Phe-NH2 DM06VGY Discovery agent N.A. Investigative [73]
Dmt-Pro-Imp-Phe-NH2 DMXUI1J Discovery agent N.A. Investigative [73]
Dmt-Pro-Mmp-Phe-NH2 DM78PFN Discovery agent N.A. Investigative [73]
Dmt-Pro-Phe-Phe-NH2 DMM8BIE Discovery agent N.A. Investigative [73]
Dmt-Pro-Tmp-Phe-NH2 DMEMQAK Discovery agent N.A. Investigative [73]
DPDPE DMIRSNA Discovery agent N.A. Investigative [74]
Drug 7684380 DML4V73 Discovery agent N.A. Investigative [75]
dynorphin B DMSPVLM Discovery agent N.A. Investigative [76]
Dynorphin(1-8) DMM92LG Discovery agent N.A. Investigative [77]
ELAEOCARPENINE DMRHSCQ Discovery agent N.A. Investigative [78]
ENDOMORPHIN 2 DMOQWBU Discovery agent N.A. Investigative [79]
ENDOMORPHIN-1 DMBJUEM Discovery agent N.A. Investigative [79]
ethyketazocine DM7390Y Discovery agent N.A. Investigative [80]
ethylketocyclazocine DM9YRCU Discovery agent N.A. Investigative [34]
ETONITAZENE DMFR1SE Discovery agent N.A. Investigative [81]
FALCARINDIOL DMLOV18 Discovery agent N.A. Investigative [60]
GR-38414 DMIY9UF Discovery agent N.A. Investigative [82]
GR-45809 DM5UOYM Discovery agent N.A. Investigative [83]
GR-86014 DMEO7CP Discovery agent N.A. Investigative [84]
GR-91272 DM9WY1D Discovery agent N.A. Investigative [84]
H-Cdp-ala-Gly-Phe-leu-OH DMV751G Discovery agent N.A. Investigative [85]
H-Cdp-Gly-Gly-Phe-Leu-OH DMVEB8C Discovery agent N.A. Investigative [85]
H-Cpa-Gly-Gly-Phe-Met-NH2 DMU6PV8 Discovery agent N.A. Investigative [85]
H-Cpa-Gly-Gly-Phe-Met-OH DM154G2 Discovery agent N.A. Investigative [85]
H-Tyr-c[D-Allylgly-Gly-Phe-D-Allylgly]-OH DMA2CZL Discovery agent N.A. Investigative [66]
H-Tyr-c[D-Allylgly-Gly-Phe-D-Allylgly]NH2 DM48XV0 Discovery agent N.A. Investigative [86]
H-Tyr-c[D-Allylgly-Gly-Phe-L-Allylgly]NH2 DMXPJHB Discovery agent N.A. Investigative [86]
H-Tyr-c[D-Cys-Gly-Phe-D-Cys]NH2 DM7QAES Discovery agent N.A. Investigative [86]
H-Tyr-c[D-Cys-Gly-Phe-L-Cys]NH2 DMZSTL5 Discovery agent N.A. Investigative [86]
H-Tyr-Gly-Gly-Phe-Met-NH2 DM6D0ZS Discovery agent N.A. Investigative [85]
HERKINORIN DMJXBWV Discovery agent N.A. Investigative [87]
HTyr-Gly-Gly-Phe-Leu-Arg-Arg-lle-Arg-Pro-LysNH2 DM25KZE Discovery agent N.A. Investigative [88]
ICI-199441 DMEWZ80 Discovery agent N.A. Investigative [89]
ICI-204448 DMNA8RS Discovery agent N.A. Investigative [90]
KETOCYCLAZOCINE DM0RC8M Discovery agent N.A. Investigative [19]
KNT-62 DM9M5HC Discovery agent N.A. Investigative [5]
KNT-63 DM0U5N9 Discovery agent N.A. Investigative [5]
L-685,818 DMJUQT1 Discovery agent N.A. Investigative [75]
LOFENTANIL DMR2WQE Discovery agent N.A. Investigative [91]
M3A6S DMJK1RE Discovery agent N.A. Investigative [68]
M3IBu6S DM0UOF1 Discovery agent N.A. Investigative [68]
M3P6S DMXT87E Discovery agent N.A. Investigative [68]
M3Pr6S DMMC8RN Discovery agent N.A. Investigative [68]
M6G thiosaccharide analogue DMRB4YV Discovery agent N.A. Investigative [61]
M6S DMFCUN4 Discovery agent N.A. Investigative [68]
MC-CAM DMAHN4L Discovery agent N.A. Investigative [92]
MCL-117 DMQIGZ7 Discovery agent N.A. Investigative [36]
MCL-139 DMQ1BDZ Discovery agent N.A. Investigative [36]
MCL-144 DMW7ZF8 Discovery agent N.A. Investigative [93]
MCL-145 DMJXU67 Discovery agent N.A. Investigative [36]
MCL-147 DMH5SMT Discovery agent N.A. Investigative [94]
MCL-149 DMTWY94 Discovery agent N.A. Investigative [94]
MCL-153 DMCPW5F Discovery agent N.A. Investigative [95]
MCL-154 DM3PIHV Discovery agent N.A. Investigative [95]
MCL-182 DM39YW1 Discovery agent N.A. Investigative [94]
MCL-183 DMVR51Z Discovery agent N.A. Investigative [94]
MCL-428 DMXBHE4 Discovery agent N.A. Investigative [96]
MCL-429 DM1XH04 Discovery agent N.A. Investigative [96]
MCL-431 DMISHCW Discovery agent N.A. Investigative [96]
MCL-432 DMPOFAR Discovery agent N.A. Investigative [96]
MCL-433 DMD3OAQ Discovery agent N.A. Investigative [96]
MCL-434 DMR31VO Discovery agent N.A. Investigative [96]
MCL-435 DMLSYD9 Discovery agent N.A. Investigative [96]
MCL-443 DM8LTQ4 Discovery agent N.A. Investigative [96]
MCL-444 DM8HALS Discovery agent N.A. Investigative [96]
MCL-445 DMR2K4F Discovery agent N.A. Investigative [94]
MCL-446 DMXF73G Discovery agent N.A. Investigative [94]
MCL-447 DMSTGNH Discovery agent N.A. Investigative [94]
MCL-448 DMSJGA9 Discovery agent N.A. Investigative [94]
MCL-449 DMQ890N Discovery agent N.A. Investigative [96]
MCL-450 DM7I6U8 Discovery agent N.A. Investigative [97]
MCL-451 DMP523A Discovery agent N.A. Investigative [97]
MCL-457 DMORMGU Discovery agent N.A. Investigative [94]
MCL-458 DMZN93Y Discovery agent N.A. Investigative [94]
METAZOCINE DMB6T23 Discovery agent N.A. Investigative [19]
MK-1925 DM3NDWK Discovery agent N.A. Investigative [98]
Morphinan Cyclic Imine analogue DMTHFSE Discovery agent N.A. Investigative [99]
MR-1029 DMS7FC6 Discovery agent N.A. Investigative [100]
MR-1526 DM5WMXJ Discovery agent N.A. Investigative [100]
MR-2034 DMF04AG Discovery agent N.A. Investigative [19]
MR-2266 DMXWSIU Discovery agent N.A. Investigative [100]
N,N-diallyl[D-Pro-10]Dyn A-(1-11) DMSY571 Discovery agent N.A. Investigative [101]
N,N-dibenzyl[D-Pro-10]Dyn A-(1-11) DMILJUE Discovery agent N.A. Investigative [101]
N,N-diCPM[D-Pro-10]Dyn A-(1-11) DM1UCZ9 Discovery agent N.A. Investigative [101]
N-(17-Methylmorphinan-3-yl)-N'-phenylurea DMFRQ2U Discovery agent N.A. Investigative [42]
N-(4-Iodophenyl)-N'-(17-methylmorphinan-3-yl)urea DMHANU5 Discovery agent N.A. Investigative [42]
N-allyl[D-Pro-10]Dyn A-(1-11) DM30LI6 Discovery agent N.A. Investigative [101]
N-Benzyl-17-(cyclobutylmethyl)morphinan-3-amine DM7SEM1 Discovery agent N.A. Investigative [42]
N-Benzyl-17-(cyclopropylmethyl)morphinan-3-amine DMLP9VM Discovery agent N.A. Investigative [42]
N-benzyl[D-Pro-10]Dyn A-(1-11) DM2YZC5 Discovery agent N.A. Investigative [101]
N-CPM[D-Pro-10]Dyn A-(1-11) DM1K64F Discovery agent N.A. Investigative [101]
N-isobutylnoroxymorphone DMN1FIU Discovery agent N.A. Investigative [102]
NalBzOH DM0CP36 Discovery agent N.A. Investigative [68]
Nalorphine DM1SCU5 Discovery agent N.A. Investigative [103]
Naltrexone-6-alpha-ol DMRAN5O Discovery agent N.A. Investigative [19]
naltriben DMNDOLZ Discovery agent N.A. Investigative [34]
Nor-binaltorphimine dihydrochloride DM6HKEC Discovery agent N.A. Investigative [63]
NORBINALTORPHIMINE DMLYZOG Discovery agent N.A. Investigative [104]
normorphine DMYQGFJ Discovery agent N.A. Investigative [34]
NRP290 DMC9XJA Pain MG30-MG3Z Investigative [34]
O-DESMETHYL TRAMADOL DM8ZG2I Discovery agent N.A. Investigative [19]
OXYMORPHINDOLE DMTP4S2 Discovery agent N.A. Investigative [105]
Oxymorphone semicarbazone hydrochloride DMTSM61 Discovery agent N.A. Investigative [77]
PHENAZOCINE DMCTVMI Discovery agent N.A. Investigative [19]
quadazocine DM2Q6JY Discovery agent N.A. Investigative [34]
RTI-5989-23 DMR4TM1 Discovery agent N.A. Investigative [30]
RTI-5989-25 DMQ28L9 Discovery agent N.A. Investigative [30]
RTI-5989-31 DMZO1QC Discovery agent N.A. Investigative [106]
Salvinicin A DM8T1Y4 Discovery agent N.A. Investigative [107]
SALVINICIN B DMB70T3 Discovery agent N.A. Investigative [107]
Salvinorin A (ester) DMYH9Q5 Discovery agent N.A. Investigative [70]
SALVINORIN B DMBR7O0 Discovery agent N.A. Investigative [87]
Salvinorin B 1-ethoxyethyl ether DM5ZE7F Discovery agent N.A. Investigative [108]
Salvinorin B 2,2,2-trifluoroethoxymethyl ether DM1DE3F Discovery agent N.A. Investigative [108]
Salvinorin B 2-fluoroethoxymethyl ether DMBAXDU Discovery agent N.A. Investigative [108]
Salvinorin B 2-methoxy-2-propyl ether DMD9A08 Discovery agent N.A. Investigative [108]
Salvinorin B 2-methoxyethoxymethyl ether DM8UATD Discovery agent N.A. Investigative [108]
Salvinorin B benzyloxymethyl ether DMKXEQ6 Discovery agent N.A. Investigative [108]
Salvinorin B butoxymethyl ether DM7Q12B Discovery agent N.A. Investigative [108]
Salvinorin B ethoxymethyl ether DMP5WNL Discovery agent N.A. Investigative [108]
Salvinorin B fluoromethyl ether DM01WOF Discovery agent N.A. Investigative [108]
Salvinorin B isopropoxymethyl ether DMSFXA3 Discovery agent N.A. Investigative [108]
Salvinorin B methoxymethyl ether DMZ51IE Discovery agent N.A. Investigative [108]
Salvinorin B methylthiomethyl ether DMKDMPL Discovery agent N.A. Investigative [108]
Salvinorin B propoxymethyl ether DMKCUY6 Discovery agent N.A. Investigative [108]
Salvinorin B tert-butoxymethyl ether DM8H6AT Discovery agent N.A. Investigative [108]
Salvinorin B tetrahydropyran-2-yl ether DM3UPAE Discovery agent N.A. Investigative [108]
SN-11 DMA0JZM Discovery agent N.A. Investigative [35]
SN-23 DM6O0PD Discovery agent N.A. Investigative [35]
SN-28 DMB8TJC Discovery agent N.A. Investigative [109]
spiradoline DMDZIV5 Discovery agent N.A. Investigative [76]
SPIROINDANYLOXYMORPHONE DMNJVZU Discovery agent N.A. Investigative [110]
tifluadom DM4QK0T Discovery agent N.A. Investigative [80]
Trans-H-Tyr-c[D-AllylGly-Gly-Phe-D-Allylgly]-OH DMBU4KJ Discovery agent N.A. Investigative [66]
U50,488H DMYW1VP Discovery agent N.A. Investigative [111]
ZYKLOPHIN DM0S5PE Discovery agent N.A. Investigative [88]
[3H]diprenorphine DMBMS1U Discovery agent N.A. Investigative [112]
[3H]U69593 DM6RSZ9 Discovery agent N.A. Investigative [113]
[Dcp1]Dyn A(1-11)-NH2 DM23GCK Discovery agent N.A. Investigative [69]
[Leu5]enkephalin DMA0N32 Discovery agent N.A. Investigative [114]
[U-13C]ascomycin DMP3I6E Discovery agent N.A. Investigative [115]
------------------------------------------------------------------------------------
⏷ Show the Full List of 247 Investigative Drug(s)

Molecular Expression Atlas (MEA) of This DTT

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTT
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Bipolar disorder 6A20 Pre-frontal cortex 9.17E-01 0.04 0.1
Multiple myeloma 2C82 Bone marrow 2.03E-01 -0.08 -0.57
------------------------------------------------------------------------------------

References

1 Pharmacological profiles of opioid ligands at kappa opioid receptors. BMC Pharmacol. 2006 Jan 25;6:3.
2 In silico identification and biochemical evaluation of novel inhibitors of NRH:quinone oxidoreductase 2 (NQO2). Bioorg Med Chem Lett. 2010 Dec 15;20(24):7331-6.
3 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
4 Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
5 Drug design and synthesis of a novel kappa opioid receptor agonist with an oxabicyclo[2.2.2]octane skeleton and its pharmacology. Bioorg Med Chem Lett. 2010 Jan 1;20(1):121-4.
6 Emerging drugs for irritable bowel syndrome. Expert Opin Emerg Drugs. 2006 May;11(2):293-313.
7 Kappa Opioid Receptor Antagonists as Potential Therapeutics for Mood and Substance Use Disorders. Handb Exp Pharmacol. 2022;271:473-491.
8 Peptide Kappa Opioid Receptor Ligands: Potential for Drug Development. AAPS J. 2009 June; 11(2): 312-322.
9 Nalbuphine: an autoradiographic opioid receptor binding profile in the central nervous system of an agonist/antagonist analgesic. J Pharmacol Exp Ther. 1988 Jan;244(1):391-402.
10 Clinical pipeline report, company report or official report of Klus Pharma
11 Novel developments with selective, non-peptidic kappa-opioid receptor agonists. Expert Opin Investig Drugs. 1997 Oct;6(10):1351-68.
12 Clinical pipeline report, company report or official report of BlackThorn Therapeutics.
13 Wax PM, Becker CE, Curry SC: Unexpected gas casualties in Moscow: a medical toxicology perspective. Ann Emerg Med. 2003 May;41(5):700-5.
14 Analgesic efficacy of peripheral kappa-opioid receptor agonist CR665 compared to oxycodone in a multi-modal, multi-tissue experimental human pain model: selective effect on visceral pain. Anesthesiology. 2009 Sep;111(3):616-24.
15 Enadoline, a selective kappa-opioid receptor agonist shows potent antihyperalgesic and antiallodynic actions in a rat model of surgical pain. Pain. 1999 Mar;80(1-2):383-9.
16 LY2456302 is a novel, potent, orally-bioavailable small molecule kappa-selective antagonist with activity in animal models predictive of efficacy in mood and addictive disorders. Neuropharmacology. 2014 Feb;77:131-44.
17 Effect of niravoline (RU51599), a kappa-opioid receptor agonist, on tumour-origin brain oedema. Acta Neurochir (Wien). 1999;141(7):771-8.
18 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2023. Adis Insight
19 Syntheses and opioid receptor binding properties of carboxamido-substituted opioids. Bioorg Med Chem Lett. 2009 Jan 1;19(1):203-8.
20 Kappa-opioid receptors behind the blood-brain barrier are involved in the anti-hypertensive effects of systemically administered kappa-agonists in the conscious spontaneously hypertensive rat. J Pharm Pharmacol. 1999 Nov;51(11):1251-6.
21 US patent application no. 6,924,288, Enantiomerically pure opioid diarylmethylpiperzine and methods of using same.
22 Design and discovery of a selective small molecule opioid antagonist (2-methyl-N-((2'-(pyrrolidin-1-ylsulfonyl)biphenyl-4-yl)methyl)propan-1-amine, PF-4455242). J Med Chem. 2011 Aug 25;54(16):5868-77.
23 Toward a structure-based model of salvinorin A recognition of the kappa-opioid receptor. J Med Chem. 2008 Mar 27;51(6):1824-30.
24 Analgesia from a peripherally active kappa-opioid receptor agonist in patients with chronic pancreatitis. Pain. 2003 Jan;101(1-2):89-95.
25 Use of receptor chimeras to identify small molecules with high affinity for the dynorphin A binding domain of the kappa opioid receptor. Bioorg Med Chem Lett. 2008 Jun 15;18(12):3667-71.
26 Systemic effects of E-2078, a stabilized dynorphin A(1-8) analog, in rhesus monkeys. Psychopharmacology (Berl). 1999 Apr;143(2):190-6.
27 Effects of R-84760, a selective kappa-opioid receptor agonist, on nociceptive reflex in isolated neonatal rat spinal cord. Eur J Pharmacol. 1998 Feb 19;343(2-3):171-7.
28 WO patent application no. 2007,0677,14, Treatment of sequelae of psychiatric disorders.
29 Emerging drugs for obesity: linking novel biological mechanisms to pharmaceutical pipelines. Expert Opin Emerg Drugs. 2005 Aug;10(3):643-60.
30 Investigation of the N-substituent conformation governing potency and mu receptor subtype-selectivity in (+)-(3R, 4R)-dimethyl-4-(3-hydroxyphenyl)p... J Med Chem. 1998 May 21;41(11):1980-90.
31 Irritable bowel syndrome neuropharmacology. A review of approved and investigational compounds. J Clin Gastroenterol. 2002 Jul;35(1 Suppl):S58-67.
32 [(11)C]-GR89696, a potent kappa opiate receptor radioligand; in vivo binding of the R and S enantiomers. Nucl Med Biol. 2002 Jan;29(1):47-53.
33 GR94839, a kappa-opioid agonist with limited access to the central nervous system, has antinociceptive activity. Br J Pharmacol. 1992 Aug;106(4):783-9.
34 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 318).
35 Design and synthesis of novel delta opioid receptor agonists and their pharmacologies. Bioorg Med Chem Lett. 2009 May 15;19(10):2792-5.
36 Synthesis and preliminary in vitro investigation of bivalent ligands containing homo- and heterodimeric pharmacophores at mu, delta, and kappa opio... J Med Chem. 2006 Jan 12;49(1):256-62.
37 Bioorg Med Chem Lett. 2007 Jun 1;17(11):3023-7. Epub 2007 Mar 23.Synthesis and structure-activity relationships of 4-hydroxy-4-phenylpiperidines as nociceptin receptor ligands: Part 1.
38 Bioorg Med Chem Lett. 2007 Jun 1;17(11):3028-33. Epub 2007 Mar 21.Synthesis and structure-activity relationships of 4-hydroxy-4-phenylpiperidines as nociceptin receptor ligands: Part 2.
39 The discovery of tropane derivatives as nociceptin receptor ligands for the management of cough and anxiety. Bioorg Med Chem Lett. 2009 May 1;19(9):2519-23.
40 Modification of the furan ring of salvinorin A: identification of a selective partial agonist at the kappa opioid receptor. Bioorg Med Chem. 2009 Feb 1;17(3):1370-80.
41 14 beta-O-cinnamoylnaltrexone and related dihydrocodeinones are mu opioid receptor partial agonists with predominant antagonist activity. J Med Chem. 2009 Mar 26;52(6):1553-7.
42 Synthesis and opioid receptor binding affinities of 2-substituted and 3-aminomorphinans: ligands for mu, kappa, and delta opioid receptors. J Med Chem. 2010 Jan 14;53(1):402-18.
43 Structural determinants of opioid activity in derivatives of 14-aminomorphinones: effect of substitution in the aromatic ring of cinnamoylaminomorp... J Med Chem. 2006 Aug 24;49(17):5333-8.
44 Synthesis and characterizations of novel quinoline derivatives having mixed ligand activities at the kappa and mu receptors: Potential therapeutic ... Bioorg Med Chem. 2009 Aug 15;17(16):5782-90.
45 Convenient synthesis and in vitro pharmacological activity of 2-thioanalogs of salvinorins A and B. Bioorg Med Chem Lett. 2007 Apr 15;17(8):2229-32.
46 3-(4-Piperidinyl)indoles and 3-(4-piperidinyl)pyrrolo-[2,3-b]pyridines as ligands for the ORL-1 receptor. Bioorg Med Chem Lett. 2006 Jul 1;16(13):3524-8.
47 Discovery of 8-azabicyclo[3.2.1]octan-3-yloxy-benzamides as selective antagonists of the kappa opioid receptor. Part 1. Bioorg Med Chem Lett. 2010 Oct 1;20(19):5847-52.
48 Syntheses of novel high affinity ligands for opioid receptors. Bioorg Med Chem Lett. 2009 Apr 15;19(8):2289-94.
49 Subramanian G, Paterlini MG, Portoghese PS, Ferguson DM: Molecular docking reveals a novel binding site model for fentanyl at the mu-opioid receptor. J Med Chem. 2000 Feb 10;43(3):381-91.
50 You HJ, Colpaert FC, Arendt-Nielsen L: The novel analgesic and high-efficacy 5-HT1A receptor agonist F 13640 inhibits nociceptive responses, wind-up, and after-discharges in spinal neurons and withdrawal reflexes. Exp Neurol. 2005 Jan;191(1):174-83.
51 Structure-activity relationship studies of carboxamido-biaryl ethers as opioid receptor antagonists (OpRAs). Part 1. Bioorg Med Chem Lett. 2007 Oct 1;17(19):5349-52.
52 Potent, orally bioavailable delta opioid receptor agonists for the treatment of pain: discovery of N,N-diethyl-4-(5-hydroxyspiro[chromene-2,4'-pipe... J Med Chem. 2008 Oct 9;51(19):5893-6.
53 Spirocyclic delta opioid receptor agonists for the treatment of pain: discovery of N,N-diethyl-3-hydroxy-4-(spiro[chromene-2,4'-piperidine]-4-yl) b... J Med Chem. 2009 Sep 24;52(18):5685-702.
54 4-Phenyl-4-[1H-imidazol-2-yl]-piperidine derivatives, a novel class of selective delta-opioid agonists. Bioorg Med Chem Lett. 2006 Jan 1;16(1):146-9.
55 Structure activity relationship studies of carboxamido-biaryl ethers as opioid receptor antagonists (OpRAs). Part 2. Bioorg Med Chem Lett. 2007 Dec 15;17(24):6841-6.
56 Synthesis of analogues of acetylmethadol and methadol as potential narcotic antagonists. J Med Chem. 1981 Jul;24(7):903-6.
57 Design, synthesis, and characterization of 6beta-naltrexol analogs, and their selectivity for in vitro opioid receptor subtypes. Bioorg Med Chem Lett. 2009 May 15;19(10):2811-4.
58 SAR development of a series of 8-azabicyclo[3.2.1]octan-3-yloxy-benzamides as kappa opioid receptor antagonists. Part 2. Bioorg Med Chem Lett. 2010 Sep 15;20(18):5405-10.
59 Redefining the structure-activity relationships of 2,6-methano-3-benzazocines. Part 6: Opioid receptor binding properties of cyclic variants of 8-c... Bioorg Med Chem. 2008 May 15;16(10):5653-64.
60 Novel coumarin glycoside and phenethyl vanillate from Notopterygium forbesii and their binding affinities for opioid and dopamine receptors. Bioorg Med Chem. 2008 Mar 15;16(6):3218-23.
61 Synthesis and in vitro biological evaluation of a carbon glycoside analogue of morphine-6-glucuronide. Bioorg Med Chem Lett. 2005 Mar 15;15(6):1583-6.
62 Beta-endorphin is a potent inhibitor of thymidine incorporation into DNA via mu- and kappa-opioid receptors in fetal rat brain cell aggregates in culture. J Neurochem. 1993 Feb;60(2):765-7.
63 Kappa-opioid receptor selectivity for ischemic neuroprotection with BRL 52537 in rats. Anesth Analg. 2003 Dec;97(6):1776-83.
64 The antitussive activity of delta-opioid receptor stimulation in guinea pigs. J Pharmacol Exp Ther. 2000 Feb;292(2):803-9.
65 Synthesis and opioid receptor affinity of morphinan and benzomorphan derivatives: mixed kappa agonists and mu agonists/antagonists as potential pha... J Med Chem. 2000 Jan 13;43(1):114-22.
66 Synthesis of stable and potent delta/mu opioid peptides: analogues of H-Tyr-c[D-Cys-Gly-Phe-D-Cys]-OH by ring-closing metathesis. J Med Chem. 2007 Jun 28;50(13):3138-42.
67 Nascent structure-activity relationship study of a diastereomeric series of kappa opioid receptor antagonists derived from CJ-15,208. Bioorg Med Chem Lett. 2009 Jul 1;19(13):3647-50.
68 Opiate receptor binding properties of morphine-, dihydromorphine-, and codeine 6-O-sulfate ester congeners. Bioorg Med Chem Lett. 2006 Aug 15;16(16):4291-5.
69 Replacement of the N-terminal tyrosine residue in opioid peptides with 3-(2,6-dimethyl-4-carbamoylphenyl)propanoic acid (Dcp) results in novel opio... J Med Chem. 2006 Aug 24;49(17):5382-5.
70 Synthesis and in vitro evaluation of salvinorin A analogues: effect of configuration at C(2) and substitution at C(18). Bioorg Med Chem Lett. 2006 Sep 1;16(17):4679-85.
71 Opiate receptor binding properties of morphine-, dihydromorphine-, and codeine 6-O-sulfate ester congeners. Bioorg Med Chem Lett. 2006 Aug 15;16(16):4291-5.
72 [6-O-methyl-11C]Diprenorphine Molecular Imaging and Contrast Agent Database (MICAD) [Internet].
73 Bifunctional [2',6'-dimethyl-L-tyrosine1]endomorphin-2 analogues substituted at position 3 with alkylated phenylalanine derivatives yield potent mi... J Med Chem. 2007 Jun 14;50(12):2753-66.
74 Opioid agonist and antagonist activities of morphindoles related to naltrindole. J Med Chem. 1992 Nov 13;35(23):4325-9.
75 FK-506-binding protein: three-dimensional structure of the complex with the antagonist L-685,818. J Biol Chem. 1993 May 25;268(15):11335-9.
76 Cloning and functional comparison of kappa and delta opioid receptors from mouse brain. Proc Natl Acad Sci U S A. 1993 Jul 15;90(14):6736-40.
77 Peptides as receptor selectivity modulators of opiate pharmacophores. J Med Chem. 1986 Jul;29(7):1222-5.
78 Synthesis and evaluation of opioid receptor-binding affinity of elaeocarpenine and its analogs. Bioorg Med Chem Lett. 2010 Mar 1;20(5):1601-3.
79 Structure-activity study on the Phe side chain arrangement of endomorphins using conformationally constrained analogues. J Med Chem. 2004 Jan 29;47(3):735-43.
80 Activation of the cloned human kappa opioid receptor by agonists enhances [35S]GTPgammaS binding to membranes: determination of potencies and efficacies of ligands. J Pharmacol Exp Ther. 1997 Aug;282(2):676-84.
81 Photoactivatable opiate derivatives as irreversible probes of the mu-opioid receptor. J Med Chem. 1990 Sep;33(9):2456-64.
82 A series of novel, highly potent and selective agonists for the kappa-opioid receptor. Br J Pharmacol. 1990 Dec;101(4):944-8.
83 J. Med. Chem. 1993,36, 2075-2083
84 Neuroprotective actions of GR89696, a highly potent and selective kappa-opioid receptor agonist.
85 Further studies of tyrosine surrogates in opioid receptor peptide ligands. Bioorg Med Chem Lett. 2007 May 1;17(9):2656-60.
86 Dicarba analogues of the cyclic enkephalin peptides H-Tyr-c[D-Cys-Gly-Phe-D(or L)-Cys]NH(2) retain high opioid activity. J Med Chem. 2007 Mar 22;50(6):1414-7.
87 Herkinorin analogues with differential beta-arrestin-2 interactions. J Med Chem. 2008 Apr 24;51(8):2421-31.
88 The effects of C-terminal modifications on the opioid activity of [N-benzylTyr(1)]dynorphin A-(1-11) analogues. J Med Chem. 2009 Nov 12;52(21):6814-21.
89 Arylacetamide-derived fluorescent probes: synthesis, biological evaluation, and direct fluorescent labeling of kappa opioid receptors in mouse micr... J Med Chem. 1996 Apr 12;39(8):1729-35.
90 ICI 204448: a kappa-opioid agonist with limited access to the CNS.
91 Potential affinity labels for the opiate receptor based on fentanyl and related compounds. J Med Chem. 1982 Aug;25(8):913-9.
92 14beta-Arylpropiolylamino-17-cyclopropylmethyl-7,8-dihydronormorphinones and related opioids. Further examples of pseudoirreversible mu opioid rece... J Med Chem. 2009 Nov 12;52(21):6926-30.
93 Univalent and bivalent ligands of butorphan: characteristics of the linking chain determine the affinity and potency of such opioid ligands. J Med Chem. 2009 Dec 10;52(23):7389-96.
94 In-vitro investigation of oxazol and urea analogues of morphinan at opioid receptors. Bioorg Med Chem. 2007 Jun 15;15(12):4106-12.
95 Effect of linker substitution on the binding of butorphan univalent and bivalent ligands to opioid receptors. Bioorg Med Chem Lett. 2010 Mar 1;20(5):1507-9.
96 High-affinity carbamate analogues of morphinan at opioid receptors. Bioorg Med Chem Lett. 2007 Mar 15;17(6):1508-11.
97 New opioid designed multiple ligand from Dmt-Tic and morphinan pharmacophores. J Med Chem. 2006 Sep 7;49(18):5640-3.
98 Identification of MK-1925: a selective, orally active and brain-penetrable opioid receptor-like 1 (ORL1) antagonist. Bioorg Med Chem Lett. 2009 Aug 15;19(16):4729-32.
99 Morphinan cyclic imines and pyrrolidines containing a constrained phenyl group: High affinity opioid agonists, Bioorg. Med. Chem. Lett. 5(24):2969-2974 (1995).
100 Electrophilic gamma-lactone kappa-opioid receptor probes. Analogues of 2'-hydroxy-2-tetrahydrofurfuryl-5,9-dimethyl-6,7-benzomorphan diastereomers. J Med Chem. 1991 Aug;34(8):2438-44.
101 Synthesis and opioid activity of [D-Pro10]dynorphin A-(1-11) analogues with N-terminal alkyl substitution. J Med Chem. 1997 Aug 15;40(17):2733-9.
102 Synthesis of N-isobutylnoroxymorphone from naltrexone by a selective cyclopropane ring opening reaction. Bioorg Med Chem Lett. 2008 Sep 15;18(18):4978-81.
103 Apparent efficacy of kappa-opioid receptor ligands on serum prolactin levels in rhesus monkeys. Eur J Pharmacol. 1999 Nov 3;383(3):305-9.
104 Synthesis of pyrrolomorphinan derivatives as kappa opioid agonists. Bioorg Med Chem Lett. 2010 Sep 1;20(17):5035-8.
105 Ligand binding to nucleic acids and proteins: Does selectivity increase with strength Eur J Med Chem. 2008 Nov;43(11):2307-15.
106 Probes for narcotic receptor mediated phenomena. 34. Synthesis and structure-activity relationships of a potent mu-agonist delta-antagonist and an ... J Med Chem. 2007 Aug 9;50(16):3765-76.
107 Synthetic studies of neoclerodane diterpenes from Salvia divinorum: preparation and opioid receptor activity of salvinicin analogues. J Med Chem. 2007 Jul 26;50(15):3596-603.
108 Standard protecting groups create potent and selective kappa opioids: salvinorin B alkoxymethyl ethers. Bioorg Med Chem. 2008 Feb 1;16(3):1279-86.
109 Design and synthesis of KNT-127, a -opioid receptor agonist effective by systemic administration. Bioorg Med Chem Lett. 2010 Nov 1;20(21):6302-5.
110 Aerobic oxidation of indolomorphinan without the 4,5-epoxy bridge and subsequent rearrangement of the oxidation product to spiroindolinonyl-C-normo... Bioorg Med Chem. 2009 Aug 15;17(16):5983-8.
111 The selective kappa-opioid receptor agonist U50,488H attenuates voluntary ethanol intake in the rat. Behav Brain Res. 2001 May;120(2):137-46.
112 kappa-Opioid receptor in humans: cDNA and genomic cloning, chromosomal assignment, functional expression, pharmacology, and expression pattern in the central nervous system. Proc Natl Acad Sci U S A.1995 Jul 18;92(15):7006-10.
113 [3H]U-69593 a highly selective ligand for the opioid kappa receptor. Eur J Pharmacol. 1985 Feb 26;109(2):281-4.
114 Carba-analogues of fentanyl are opioid receptor agonists. J Med Chem. 2010 Apr 8;53(7):2875-81.
115 NMR studies of an FK-506 analog, [U-13C]ascomycin, bound to FK-506-binding protein. J Med Chem. 1992 Jun 26;35(13):2467-73.