Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTQW87Y)

• DTT Name: Opioid receptor kappa (OPRK1)
• Synonyms: OPRK; Kappa-type opioid receptor; Kappa opioid receptor; KOR-1; KOR; K-OR-1
• Gene Name: OPRK1
• DTT Type: Successful target; [1]
• BioChemical Class: GPCR rhodopsin
• UniProt ID: OPRK_HUMAN
• TTD ID: T60693
• Sequence:
  MDSPIQIFRGEPGPTCAPSACLPPNSSAWFPGWAEPDSNGSAGSEDAQLEPAHISPAIPV
  IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYL
  MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI
  CIWLLSSSVGISAIVLGGTKVREDVDVIECSLQFPDDDYSWWDLFMKICVFIFAFVIPVL
  IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFVVCWTPIHIFILVEALG
  STSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPLKMRMERQSTSRV
  RNTVQDPAYLRDIDGMNKPV
• Function: Functions as receptor for various synthetic opioids and for the psychoactive diterpene salvinorin A. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Signaling leads to the inhibition of adenylate cyclase activity. Inhibits neurotransmitter release by reducing calcium ion currents and increasing potassium ion conductance. Plays a role in the perception of pain. Plays a role in mediating reduced physical activity upon treatment with synthetic opioids. Plays a role in the regulation of salivation in response to synthetic opioids. May play a role in arousal and regulation of autonomic and neuroendocrine functions. G-protein coupled opioid receptor that functions as receptor for endogenous alpha-neoendorphins and dynorphins, but has low affinity for beta-endorphins.
• KEGG Pathway: Neuroactive ligand-receptor interaction (hsa04080)
• Reactome Pathway:
  G alpha (i) signalling events (R-HSA-418594)
  Peptide ligand-binding receptors (R-HSA-375276)

Molecular Interaction Atlas (MIA) of This DTT

5 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
CHLOROXINE	DMFZBMQ	Erythema	ME64.0	Approved	[2]
Dezocine	DMJDB0Y	Pain	MG30-MG3Z	Approved	[1]
Difelikefalin	DMHZBEO	Pruritus	EC90	Approved	[3]
Nalbuphine	DMOSQGU	Pain	MG30-MG3Z	Approved	[4]
Nalfurafine hcl	DMA9DHW	Uremic pruritus	EC90.10	Approved	[5]

18 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Asimadoline	DMND3AB	Diarrhea-predominant irritable bowel syndrome	DD91.01	Phase 3	[6]
JNJ 67953964	DMJ8Y5N	Major depressive disorder	6A70.3	Phase 3	[7]
CR-845	DMJYTUQ	Pain	MG30-MG3Z	Phase 2/3	[8]
PHN-131	DM1SV8I	Pain	MG30-MG3Z	Phase 2/3	[9]
A277	DMIYY96	Chronic pain	MG30	Phase 2	[10]
Apadoline	DM1B8IT	Pain	MG30-MG3Z	Phase 2	[11]
BTRX-335140	DMWPDUZ	Major depressive disorder	6A70.3	Phase 2	[12]
Carfentanil	DM7ADGX	N. A.	N. A.	Phase 2	[13]
CR-665	DMNC1AF	Pain	MG30-MG3Z	Phase 2	[14]
Enadoline	DMGFZOL	Pain	MG30-MG3Z	Phase 2	[15]
LY-2456302	DMLTSDC	Alcohol dependence	6C40.2	Phase 2	[16]
Niravoline	DM81SDB	Pain	MG30-MG3Z	Phase 2	[17]
ORP-101	DMSH20P	Irritable bowel syndrome	DD91.0	Phase 2	[18]
AIKO-150	DMW9ZFS	Opioid dependence	6C43.2Z	Phase 1	[19]
BRL-52656	DM1V9YG	Pain	MG30-MG3Z	Phase 1	[20]
MCP-201	DMW9YOJ	Pain	MG30-MG3Z	Phase 1	[21]
PF-4455242	DMYR7XP	Bipolar disorder	6A60	Phase 1	[22]
SALVINORIN A	DMJ3HQY	Cerebral vasospasm	BA85.Z	Phase 1	[23]

11 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
CLIOQUINOL	DM746BZ	N. A.	N. A.	Withdrawn from market	[2]
ADL 10-0101	DMPFQLX	Pain	MG30-MG3Z	Discontinued in Phase 2	[24]
Dynorphin a	DMT2WVP	N. A.	N. A.	Discontinued in Phase 2	[25]
E-2078	DMHEW40	Pain	MG30-MG3Z	Discontinued in Phase 2	[26]
R-84760	DM4O7KA	Pain	MG30-MG3Z	Discontinued in Phase 2	[27]
VP004	DMXK8FQ	Substance use disorder	6C4Z	Discontinued in Phase 1	[28]
Fedotozine	DMJX1IB	N. A.	N. A.	Terminated	[31]
GR-89696	DMTGH8N	Neurodegenerative disorder	8A20-8A23	Terminated	[32]
GR-94839	DM96KF7	Pain	MG30-MG3Z	Terminated	[33]
KT-95	DM8VMJ3	Inflammatory bowel disease	DD72	Terminated	[34]
SB-213698	DM58PKG	N. A.	N. A.	Terminated	[35]

2 Preclinical Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
GNTI	DMTJRLU	Obesity	5B81	Preclinical	[29]
LY-25582	DM2N637	Obesity	5B81	Preclinical	[30]

247 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(-)-cyclorphan	DMC8WS4	Discovery agent	N.A.	Investigative	[36]
1-(1,2-diphenylethyl)-4-phenylpiperidin-4-ol	DMOR9EK	Discovery agent	N.A.	Investigative	[37]
1-(2-ethoxy-1-phenylethyl)-4-phenylpiperidin-4-ol	DMV3FSH	Discovery agent	N.A.	Investigative	[37]
1-(dio-tolylmethyl)-4-phenylpiperidin-4-ol	DMLYO8P	Discovery agent	N.A.	Investigative	[37]
1-benzhydryl-4-(2-fluorophenyl)piperidin-4-ol	DMTANPG	Discovery agent	N.A.	Investigative	[38]
1-benzhydryl-4-(2-methoxyphenyl)piperidin-4-ol	DMWHMNY	Discovery agent	N.A.	Investigative	[38]
1-benzhydryl-4-(3-fluorophenyl)piperidin-4-ol	DMXZFPB	Discovery agent	N.A.	Investigative	[38]
1-benzhydryl-4-(3-methoxyphenyl)piperidin-4-ol	DM1QYS8	Discovery agent	N.A.	Investigative	[38]
1-benzhydryl-4-(3-phenylpropyl)piperidin-4-ol	DMIT7SH	Discovery agent	N.A.	Investigative	[38]
1-benzhydryl-4-(4-bromophenyl)piperidin-4-ol	DM0BQYX	Discovery agent	N.A.	Investigative	[38]
1-benzhydryl-4-(4-chlorophenyl)piperidin-4-ol	DMWYG8K	Discovery agent	N.A.	Investigative	[38]
1-benzhydryl-4-(4-ethylphenyl)piperidin-4-ol	DME0BJD	Discovery agent	N.A.	Investigative	[38]
1-benzhydryl-4-(4-fluorophenyl)piperidin-4-ol	DMRNZD6	Discovery agent	N.A.	Investigative	[38]
1-benzhydryl-4-(4-methoxyphenyl)piperidin-4-ol	DMXT894	Discovery agent	N.A.	Investigative	[38]
1-benzhydryl-4-(4-propylphenyl)piperidin-4-ol	DMJDUM5	Discovery agent	N.A.	Investigative	[38]
1-benzhydryl-4-(benzyloxy)-4-phenylpiperidine	DMDRUBL	Discovery agent	N.A.	Investigative	[37]
1-benzhydryl-4-(furan-2-yl)piperidin-4-ol	DMMB2GV	Discovery agent	N.A.	Investigative	[38]
1-benzhydryl-4-(pyridin-2-yl)piperidin-4-ol	DMJ8F60	Discovery agent	N.A.	Investigative	[38]
1-benzhydryl-4-(thiophen-2-yl)piperidin-4-ol	DMNOZR2	Discovery agent	N.A.	Investigative	[38]
1-benzhydryl-4-benzylpiperidin-4-ol	DMVBR36	Discovery agent	N.A.	Investigative	[38]
1-benzhydryl-4-butylpiperidin-4-ol	DMRN7SC	Discovery agent	N.A.	Investigative	[38]
1-benzhydryl-4-cyclohexylpiperidin-4-ol	DMZVSYD	Discovery agent	N.A.	Investigative	[38]
1-benzhydryl-4-ethoxy-4-phenylpiperidine	DM6PIL2	Discovery agent	N.A.	Investigative	[37]
1-benzhydryl-4-hexylpiperidin-4-ol	DMUK95S	Discovery agent	N.A.	Investigative	[38]
1-benzhydryl-4-isopropylpiperidin-4-ol	DMGYCQ3	Discovery agent	N.A.	Investigative	[38]
1-benzhydryl-4-m-tolylpiperidin-4-ol	DMVJH1S	Discovery agent	N.A.	Investigative	[38]
1-benzhydryl-4-methoxy-4-phenylpiperidine	DMBG0N8	Discovery agent	N.A.	Investigative	[37]
1-benzhydryl-4-o-tolylpiperidin-4-ol	DMVUMSF	Discovery agent	N.A.	Investigative	[38]
1-benzhydryl-4-p-tolylpiperidin-4-ol	DM679RC	Discovery agent	N.A.	Investigative	[38]
1-benzhydryl-4-phenyl-4-propoxypiperidine	DMEB968	Discovery agent	N.A.	Investigative	[37]
1-benzhydryl-4-phenylpiperidin-4-ol	DM7KU1X	Discovery agent	N.A.	Investigative	[39]
1-benzhydryl-4-tert-butylpiperidin-4-ol	DMM5DTF	Discovery agent	N.A.	Investigative	[38]
12-EPI-SALVINORIN A	DMZ9PW3	Discovery agent	N.A.	Investigative	[40]
14-O-phenylpropylnaltrexone	DMI7LXH	Discovery agent	N.A.	Investigative	[41]
17-(Cyclobutylmethyl)-N-phenylmorphinan-3-amine	DMUQWPZ	Discovery agent	N.A.	Investigative	[42]
17-(Cyclopropylmethyl)-N-phenylmorphinan-3-amine	DM174HN	Discovery agent	N.A.	Investigative	[42]
17-methyl-4'-methyldihydromorphinone	DMMEB64	Discovery agent	N.A.	Investigative	[43]
17-Methylmorphinan-3-yl 4-Iodophenyl Carbamate	DMI4WCQ	Discovery agent	N.A.	Investigative	[42]
2-(2-methylquinolin-4-ylamino)-N-phenylacetamide	DMW75IF	Discovery agent	N.A.	Investigative	[44]
2-Benzylaminomethyl-3-hydroxymorphinan	DM6EMGJ	Discovery agent	N.A.	Investigative	[42]
2-EPI-2-THIOSALVINORIN A	DM2PDGO	Discovery agent	N.A.	Investigative	[45]
2-EPI-2-THIOSALVINORIN B	DMZXIW0	Discovery agent	N.A.	Investigative	[45]
2-Hydroxymethyl-3-hydroxymorphinan	DM4LMPD	Discovery agent	N.A.	Investigative	[42]
2-THIOSALVINORIN B	DMIEGF4	Discovery agent	N.A.	Investigative	[45]
3-(1-benzylpiperidin-4-yl)-5-chloro-1H-indole	DM2YKHI	Discovery agent	N.A.	Investigative	[46]
3-(1-benzylpiperidin-4-yloxy)benzamide	DMG3A4Z	Discovery agent	N.A.	Investigative	[47]
3-desoxy-3-carboxamidonaltrexone	DMBNA0V	Discovery agent	N.A.	Investigative	[48]
3-Methylfentanyl	DMX71N9	Discovery agent	N.A.	Investigative	[49]
3-Methylthiofentanyl	DMC153X	Discovery agent	N.A.	Investigative	[50]
4-(4-((phenethylamino)methyl)phenoxy)benzamide	DM0QRJ3	Discovery agent	N.A.	Investigative	[51]
4-(p-Tolyl)spiro[chromene-2,4'-piperidine]	DMIOQJD	Discovery agent	N.A.	Investigative	[52]
4-(Spiro[chromene-2,4'-piperidine]-4-yl)benzamide	DM0XDG6	Discovery agent	N.A.	Investigative	[53]
4-(Spiro[chromene-2,4'-piperidine]-4-yl)phenol	DM8ZRAE	Discovery agent	N.A.	Investigative	[52]
4-phenyl-1-(1-phenylbutyl)piperidin-4-ol	DMVCIJB	Discovery agent	N.A.	Investigative	[37]
4-phenyl-1-(1-phenylethyl)piperidin-4-ol	DM6EFLV	Discovery agent	N.A.	Investigative	[37]
4-phenyl-1-(1-phenylheptyl)piperidin-4-ol	DMISTXQ	Discovery agent	N.A.	Investigative	[37]
4-phenyl-1-(1-phenylhexyl)piperidin-4-ol	DM1GRWY	Discovery agent	N.A.	Investigative	[37]
4-phenyl-1-(1-phenylpentyl)piperidin-4-ol	DMZQ7DP	Discovery agent	N.A.	Investigative	[37]
4-phenyl-1-(1-phenylpropyl)piperidin-4-ol	DMALIQ8	Discovery agent	N.A.	Investigative	[37]
4-phenyl-1-(phenyl(m-tolyl)methyl)piperidin-4-ol	DMFV0JC	Discovery agent	N.A.	Investigative	[37]
4-phenyl-1-(phenyl(o-tolyl)methyl)piperidin-4-ol	DM2MPWC	Discovery agent	N.A.	Investigative	[37]
4-phenyl-1-(phenyl(p-tolyl)methyl)piperidin-4-ol	DM5R6T4	Discovery agent	N.A.	Investigative	[37]
4-phenyl-4-[1H-imidazol-2-yl]-piperidine	DMPY4G1	Discovery agent	N.A.	Investigative	[54]
4-Phenylspiro[chromene-2,4'-piperidine]	DMW46K7	Discovery agent	N.A.	Investigative	[52]
5-(4-((phenethylamino)methyl)phenoxy)picolinamide	DMZYE8W	Discovery agent	N.A.	Investigative	[51]
6-(4-((benzylamino)methyl)phenoxy)nicotinamide	DMEM1BA	Discovery agent	N.A.	Investigative	[51]
6-(4-((phenethylamino)methyl)phenoxy)nicotinamide	DM9VD4W	Discovery agent	N.A.	Investigative	[55]
6-(4-(2-(benzylamino)ethyl)phenoxy)nicotinamide	DMDKOWP	Discovery agent	N.A.	Investigative	[55]
6-(4-(3-(benzylamino)propyl)phenoxy)nicotinamide	DMDTMB7	Discovery agent	N.A.	Investigative	[51]
6-(Allyl-methyl-amino)-4,4-diphenyl-heptan-3-ol	DMYMJHF	Discovery agent	N.A.	Investigative	[56]
6-desoxonaltrexone	DMGZQNS	Discovery agent	N.A.	Investigative	[48]
6beta-naltrexol HCl	DMZ8PBE	Discovery agent	N.A.	Investigative	[57]
8-azabicyclo[3.2.1]octan-3-yloxy-benzamide	DMQMSZR	Discovery agent	N.A.	Investigative	[58]
8-carboxamidocyclazocine	DMD18V5	Discovery agent	N.A.	Investigative	[59]
ANISOCOUMARIN H	DMHA9S3	Discovery agent	N.A.	Investigative	[60]
Benzyl derivative of M6G	DMX8W4G	Discovery agent	N.A.	Investigative	[61]
Beta-endorphin	DM7XC6B	Discovery agent	N.A.	Investigative	[62]
Bis-((-)-N-propargylmorphinan-3-yl) sebacoylate	DM0WKNI	Discovery agent	N.A.	Investigative	[36]
BRL 52537 hydrochloride	DM16GUV	Discovery agent	N.A.	Investigative	[63]
BRL 52974	DM6XO72	Discovery agent	N.A.	Investigative	[64]
BUTORPHAN	DM82KPQ	Discovery agent	N.A.	Investigative	[65]
Cis-H-Tyr-c[D-AllylGly-Gly-Phe-D-Allylgly]-OH	DMQUB19	Discovery agent	N.A.	Investigative	[66]
Clocinnamox	DMZLMJH	Discovery agent	N.A.	Investigative	[41]
CYCLAZOCINE	DMC6DAZ	Discovery agent	N.A.	Investigative	[65]
CYCLORPHAN	DMB1U8V	Discovery agent	N.A.	Investigative	[65]
C[L-Ala-D-pro-L-Phe-D-trp]	DMHXTWK	Discovery agent	N.A.	Investigative	[67]
C[L-mTyr-D-pro-L-Phe-D-trp]	DMNHSR0	Discovery agent	N.A.	Investigative	[67]
C[L-Phe-D-pro-L-mTyr-D-trp]	DM82ZOM	Discovery agent	N.A.	Investigative	[67]
C[L-Phe-D-pro-L-Phe-D-trp]	DM0NTU5	Discovery agent	N.A.	Investigative	[67]
C[L-Phe-D-pro-L-Phe-L-trp]	DMCY4L0	Discovery agent	N.A.	Investigative	[67]
C[L-Phe-D-pro-L-Tyr(OMe)-D-trp]	DM4M3OP	Discovery agent	N.A.	Investigative	[67]
C[L-Phe-D-pro-L-Tyr-D-trp]	DMADSBT	Discovery agent	N.A.	Investigative	[67]
C[L-Tyr(OMe)-D-pro-L-Phe-D-trp]	DMLB6UA	Discovery agent	N.A.	Investigative	[67]
C[L-Tyr-D-pro-L-Phe-D-trp]	DM7OIY8	Discovery agent	N.A.	Investigative	[67]
DAMGO	DMS1DVA	Discovery agent	N.A.	Investigative	[68]
Dcp-c[D-Cys-Gly-Phe(pNO2)-D-Cys]NH2	DMU287Q	Discovery agent	N.A.	Investigative	[69]
DEOXY SALVINORIN A	DM5JFKX	Discovery agent	N.A.	Investigative	[70]
Deprotected cogener of M6G	DMH340E	Discovery agent	N.A.	Investigative	[61]
Dhp-c[D-Cys-Gly-Phe(pNO2)-D-Cys]NH2	DMSN87T	Discovery agent	N.A.	Investigative	[69]
Dihydromorphine	DM4TR0D	Discovery agent	N.A.	Investigative	[71]
Dimepheptanol	DMRMHE8	Discovery agent	N.A.	Investigative	[56]
Diprenorphine	DMIXPU6	Discovery agent	N.A.	Investigative	[72]
DM6S	DMAJ0Q8	Discovery agent	N.A.	Investigative	[68]
Dmt-Pro-3,5Dmp-Phe-NH2	DM5WEFK	Discovery agent	N.A.	Investigative	[73]
Dmt-Pro-Dmp-Phe-NH2	DMGUIR1	Discovery agent	N.A.	Investigative	[73]
Dmt-Pro-Dmt-Phe-NH2	DM4VEU2	Discovery agent	N.A.	Investigative	[73]
Dmt-Pro-Emp-Phe-NH2	DM06VGY	Discovery agent	N.A.	Investigative	[73]
Dmt-Pro-Imp-Phe-NH2	DMXUI1J	Discovery agent	N.A.	Investigative	[73]
Dmt-Pro-Mmp-Phe-NH2	DM78PFN	Discovery agent	N.A.	Investigative	[73]
Dmt-Pro-Phe-Phe-NH2	DMM8BIE	Discovery agent	N.A.	Investigative	[73]
Dmt-Pro-Tmp-Phe-NH2	DMEMQAK	Discovery agent	N.A.	Investigative	[73]
DPDPE	DMIRSNA	Discovery agent	N.A.	Investigative	[74]
Drug 7684380	DML4V73	Discovery agent	N.A.	Investigative	[75]
dynorphin B	DMSPVLM	Discovery agent	N.A.	Investigative	[76]
Dynorphin(1-8)	DMM92LG	Discovery agent	N.A.	Investigative	[77]
ELAEOCARPENINE	DMRHSCQ	Discovery agent	N.A.	Investigative	[78]
ENDOMORPHIN 2	DMOQWBU	Discovery agent	N.A.	Investigative	[79]
ENDOMORPHIN-1	DMBJUEM	Discovery agent	N.A.	Investigative	[79]
ethyketazocine	DM7390Y	Discovery agent	N.A.	Investigative	[80]
ethylketocyclazocine	DM9YRCU	Discovery agent	N.A.	Investigative	[34]
ETONITAZENE	DMFR1SE	Discovery agent	N.A.	Investigative	[81]
FALCARINDIOL	DMLOV18	Discovery agent	N.A.	Investigative	[60]
GR-38414	DMIY9UF	Discovery agent	N.A.	Investigative	[82]
GR-45809	DM5UOYM	Discovery agent	N.A.	Investigative	[83]
GR-86014	DMEO7CP	Discovery agent	N.A.	Investigative	[84]
GR-91272	DM9WY1D	Discovery agent	N.A.	Investigative	[84]
H-Cdp-ala-Gly-Phe-leu-OH	DMV751G	Discovery agent	N.A.	Investigative	[85]
H-Cdp-Gly-Gly-Phe-Leu-OH	DMVEB8C	Discovery agent	N.A.	Investigative	[85]
H-Cpa-Gly-Gly-Phe-Met-NH2	DMU6PV8	Discovery agent	N.A.	Investigative	[85]
H-Cpa-Gly-Gly-Phe-Met-OH	DM154G2	Discovery agent	N.A.	Investigative	[85]
H-Tyr-c[D-Allylgly-Gly-Phe-D-Allylgly]-OH	DMA2CZL	Discovery agent	N.A.	Investigative	[66]
H-Tyr-c[D-Allylgly-Gly-Phe-D-Allylgly]NH2	DM48XV0	Discovery agent	N.A.	Investigative	[86]
H-Tyr-c[D-Allylgly-Gly-Phe-L-Allylgly]NH2	DMXPJHB	Discovery agent	N.A.	Investigative	[86]
H-Tyr-c[D-Cys-Gly-Phe-D-Cys]NH2	DM7QAES	Discovery agent	N.A.	Investigative	[86]
H-Tyr-c[D-Cys-Gly-Phe-L-Cys]NH2	DMZSTL5	Discovery agent	N.A.	Investigative	[86]
H-Tyr-Gly-Gly-Phe-Met-NH2	DM6D0ZS	Discovery agent	N.A.	Investigative	[85]
HERKINORIN	DMJXBWV	Discovery agent	N.A.	Investigative	[87]
HTyr-Gly-Gly-Phe-Leu-Arg-Arg-lle-Arg-Pro-LysNH2	DM25KZE	Discovery agent	N.A.	Investigative	[88]
ICI-199441	DMEWZ80	Discovery agent	N.A.	Investigative	[89]
ICI-204448	DMNA8RS	Discovery agent	N.A.	Investigative	[90]
KETOCYCLAZOCINE	DM0RC8M	Discovery agent	N.A.	Investigative	[19]
KNT-62	DM9M5HC	Discovery agent	N.A.	Investigative	[5]
KNT-63	DM0U5N9	Discovery agent	N.A.	Investigative	[5]
L-685,818	DMJUQT1	Discovery agent	N.A.	Investigative	[75]
LOFENTANIL	DMR2WQE	Discovery agent	N.A.	Investigative	[91]
M3A6S	DMJK1RE	Discovery agent	N.A.	Investigative	[68]
M3IBu6S	DM0UOF1	Discovery agent	N.A.	Investigative	[68]
M3P6S	DMXT87E	Discovery agent	N.A.	Investigative	[68]
M3Pr6S	DMMC8RN	Discovery agent	N.A.	Investigative	[68]
M6G thiosaccharide analogue	DMRB4YV	Discovery agent	N.A.	Investigative	[61]
M6S	DMFCUN4	Discovery agent	N.A.	Investigative	[68]
MC-CAM	DMAHN4L	Discovery agent	N.A.	Investigative	[92]
MCL-117	DMQIGZ7	Discovery agent	N.A.	Investigative	[36]
MCL-139	DMQ1BDZ	Discovery agent	N.A.	Investigative	[36]
MCL-144	DMW7ZF8	Discovery agent	N.A.	Investigative	[93]
MCL-145	DMJXU67	Discovery agent	N.A.	Investigative	[36]
MCL-147	DMH5SMT	Discovery agent	N.A.	Investigative	[94]
MCL-149	DMTWY94	Discovery agent	N.A.	Investigative	[94]
MCL-153	DMCPW5F	Discovery agent	N.A.	Investigative	[95]
MCL-154	DM3PIHV	Discovery agent	N.A.	Investigative	[95]
MCL-182	DM39YW1	Discovery agent	N.A.	Investigative	[94]
MCL-183	DMVR51Z	Discovery agent	N.A.	Investigative	[94]
MCL-428	DMXBHE4	Discovery agent	N.A.	Investigative	[96]
MCL-429	DM1XH04	Discovery agent	N.A.	Investigative	[96]
MCL-431	DMISHCW	Discovery agent	N.A.	Investigative	[96]
MCL-432	DMPOFAR	Discovery agent	N.A.	Investigative	[96]
MCL-433	DMD3OAQ	Discovery agent	N.A.	Investigative	[96]
MCL-434	DMR31VO	Discovery agent	N.A.	Investigative	[96]
MCL-435	DMLSYD9	Discovery agent	N.A.	Investigative	[96]
MCL-443	DM8LTQ4	Discovery agent	N.A.	Investigative	[96]
MCL-444	DM8HALS	Discovery agent	N.A.	Investigative	[96]
MCL-445	DMR2K4F	Discovery agent	N.A.	Investigative	[94]
MCL-446	DMXF73G	Discovery agent	N.A.	Investigative	[94]
MCL-447	DMSTGNH	Discovery agent	N.A.	Investigative	[94]
MCL-448	DMSJGA9	Discovery agent	N.A.	Investigative	[94]
MCL-449	DMQ890N	Discovery agent	N.A.	Investigative	[96]
MCL-450	DM7I6U8	Discovery agent	N.A.	Investigative	[97]
MCL-451	DMP523A	Discovery agent	N.A.	Investigative	[97]
MCL-457	DMORMGU	Discovery agent	N.A.	Investigative	[94]
MCL-458	DMZN93Y	Discovery agent	N.A.	Investigative	[94]
METAZOCINE	DMB6T23	Discovery agent	N.A.	Investigative	[19]
MK-1925	DM3NDWK	Discovery agent	N.A.	Investigative	[98]
Morphinan Cyclic Imine analogue	DMTHFSE	Discovery agent	N.A.	Investigative	[99]
MR-1029	DMS7FC6	Discovery agent	N.A.	Investigative	[100]
MR-1526	DM5WMXJ	Discovery agent	N.A.	Investigative	[100]
MR-2034	DMF04AG	Discovery agent	N.A.	Investigative	[19]
MR-2266	DMXWSIU	Discovery agent	N.A.	Investigative	[100]
N,N-diallyl[D-Pro-10]Dyn A-(1-11)	DMSY571	Discovery agent	N.A.	Investigative	[101]
N,N-dibenzyl[D-Pro-10]Dyn A-(1-11)	DMILJUE	Discovery agent	N.A.	Investigative	[101]
N,N-diCPM[D-Pro-10]Dyn A-(1-11)	DM1UCZ9	Discovery agent	N.A.	Investigative	[101]
N-(17-Methylmorphinan-3-yl)-N'-phenylurea	DMFRQ2U	Discovery agent	N.A.	Investigative	[42]
N-(4-Iodophenyl)-N'-(17-methylmorphinan-3-yl)urea	DMHANU5	Discovery agent	N.A.	Investigative	[42]
N-allyl[D-Pro-10]Dyn A-(1-11)	DM30LI6	Discovery agent	N.A.	Investigative	[101]
N-Benzyl-17-(cyclobutylmethyl)morphinan-3-amine	DM7SEM1	Discovery agent	N.A.	Investigative	[42]
N-Benzyl-17-(cyclopropylmethyl)morphinan-3-amine	DMLP9VM	Discovery agent	N.A.	Investigative	[42]
N-benzyl[D-Pro-10]Dyn A-(1-11)	DM2YZC5	Discovery agent	N.A.	Investigative	[101]
N-CPM[D-Pro-10]Dyn A-(1-11)	DM1K64F	Discovery agent	N.A.	Investigative	[101]
N-isobutylnoroxymorphone	DMN1FIU	Discovery agent	N.A.	Investigative	[102]
NalBzOH	DM0CP36	Discovery agent	N.A.	Investigative	[68]
Nalorphine	DM1SCU5	Discovery agent	N.A.	Investigative	[103]
Naltrexone-6-alpha-ol	DMRAN5O	Discovery agent	N.A.	Investigative	[19]
naltriben	DMNDOLZ	Discovery agent	N.A.	Investigative	[34]
Nor-binaltorphimine dihydrochloride	DM6HKEC	Discovery agent	N.A.	Investigative	[63]
NORBINALTORPHIMINE	DMLYZOG	Discovery agent	N.A.	Investigative	[104]
normorphine	DMYQGFJ	Discovery agent	N.A.	Investigative	[34]
NRP290	DMC9XJA	Pain	MG30-MG3Z	Investigative	[34]
O-DESMETHYL TRAMADOL	DM8ZG2I	Discovery agent	N.A.	Investigative	[19]
OXYMORPHINDOLE	DMTP4S2	Discovery agent	N.A.	Investigative	[105]
Oxymorphone semicarbazone hydrochloride	DMTSM61	Discovery agent	N.A.	Investigative	[77]
PHENAZOCINE	DMCTVMI	Discovery agent	N.A.	Investigative	[19]
quadazocine	DM2Q6JY	Discovery agent	N.A.	Investigative	[34]
RTI-5989-23	DMR4TM1	Discovery agent	N.A.	Investigative	[30]
RTI-5989-25	DMQ28L9	Discovery agent	N.A.	Investigative	[30]
RTI-5989-31	DMZO1QC	Discovery agent	N.A.	Investigative	[106]
Salvinicin A	DM8T1Y4	Discovery agent	N.A.	Investigative	[107]
SALVINICIN B	DMB70T3	Discovery agent	N.A.	Investigative	[107]
Salvinorin A (ester)	DMYH9Q5	Discovery agent	N.A.	Investigative	[70]
SALVINORIN B	DMBR7O0	Discovery agent	N.A.	Investigative	[87]
Salvinorin B 1-ethoxyethyl ether	DM5ZE7F	Discovery agent	N.A.	Investigative	[108]
Salvinorin B 2,2,2-trifluoroethoxymethyl ether	DM1DE3F	Discovery agent	N.A.	Investigative	[108]
Salvinorin B 2-fluoroethoxymethyl ether	DMBAXDU	Discovery agent	N.A.	Investigative	[108]
Salvinorin B 2-methoxy-2-propyl ether	DMD9A08	Discovery agent	N.A.	Investigative	[108]
Salvinorin B 2-methoxyethoxymethyl ether	DM8UATD	Discovery agent	N.A.	Investigative	[108]
Salvinorin B benzyloxymethyl ether	DMKXEQ6	Discovery agent	N.A.	Investigative	[108]
Salvinorin B butoxymethyl ether	DM7Q12B	Discovery agent	N.A.	Investigative	[108]
Salvinorin B ethoxymethyl ether	DMP5WNL	Discovery agent	N.A.	Investigative	[108]
Salvinorin B fluoromethyl ether	DM01WOF	Discovery agent	N.A.	Investigative	[108]
Salvinorin B isopropoxymethyl ether	DMSFXA3	Discovery agent	N.A.	Investigative	[108]
Salvinorin B methoxymethyl ether	DMZ51IE	Discovery agent	N.A.	Investigative	[108]
Salvinorin B methylthiomethyl ether	DMKDMPL	Discovery agent	N.A.	Investigative	[108]
Salvinorin B propoxymethyl ether	DMKCUY6	Discovery agent	N.A.	Investigative	[108]
Salvinorin B tert-butoxymethyl ether	DM8H6AT	Discovery agent	N.A.	Investigative	[108]
Salvinorin B tetrahydropyran-2-yl ether	DM3UPAE	Discovery agent	N.A.	Investigative	[108]
SN-11	DMA0JZM	Discovery agent	N.A.	Investigative	[35]
SN-23	DM6O0PD	Discovery agent	N.A.	Investigative	[35]
SN-28	DMB8TJC	Discovery agent	N.A.	Investigative	[109]
spiradoline	DMDZIV5	Discovery agent	N.A.	Investigative	[76]
SPIROINDANYLOXYMORPHONE	DMNJVZU	Discovery agent	N.A.	Investigative	[110]
tifluadom	DM4QK0T	Discovery agent	N.A.	Investigative	[80]
Trans-H-Tyr-c[D-AllylGly-Gly-Phe-D-Allylgly]-OH	DMBU4KJ	Discovery agent	N.A.	Investigative	[66]
U50,488H	DMYW1VP	Discovery agent	N.A.	Investigative	[111]
ZYKLOPHIN	DM0S5PE	Discovery agent	N.A.	Investigative	[88]
[3H]diprenorphine	DMBMS1U	Discovery agent	N.A.	Investigative	[112]
[3H]U69593	DM6RSZ9	Discovery agent	N.A.	Investigative	[113]
[Dcp1]Dyn A(1-11)-NH2	DM23GCK	Discovery agent	N.A.	Investigative	[69]
[Leu5]enkephalin	DMA0N32	Discovery agent	N.A.	Investigative	[114]
[U-13C]ascomycin	DMP3I6E	Discovery agent	N.A.	Investigative	[115]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Bipolar disorder	6A20	Pre-frontal cortex	9.17E-01	0.04	0.1
Multiple myeloma	2C82	Bone marrow	2.03E-01	-0.08	-0.57

References

• [1] Pharmacological profiles of opioid ligands at kappa opioid receptors. BMC Pharmacol. 2006 Jan 25;6:3.
• [2] In silico identification and biochemical evaluation of novel inhibitors of NRH:quinone oxidoreductase 2 (NQO2). Bioorg Med Chem Lett. 2010 Dec 15;20(24):7331-6.
• [3] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
• [4] Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
• [5] Drug design and synthesis of a novel kappa opioid receptor agonist with an oxabicyclo[2.2.2]octane skeleton and its pharmacology. Bioorg Med Chem Lett. 2010 Jan 1;20(1):121-4.
• [6] Emerging drugs for irritable bowel syndrome. Expert Opin Emerg Drugs. 2006 May;11(2):293-313.
• [7] Kappa Opioid Receptor Antagonists as Potential Therapeutics for Mood and Substance Use Disorders. Handb Exp Pharmacol. 2022;271:473-491.
• [8] Peptide Kappa Opioid Receptor Ligands: Potential for Drug Development. AAPS J. 2009 June; 11(2): 312-322.
• [9] Nalbuphine: an autoradiographic opioid receptor binding profile in the central nervous system of an agonist/antagonist analgesic. J Pharmacol Exp Ther. 1988 Jan;244(1):391-402.
• [10] Clinical pipeline report, company report or official report of Klus Pharma
• [11] Novel developments with selective, non-peptidic kappa-opioid receptor agonists. Expert Opin Investig Drugs. 1997 Oct;6(10):1351-68.
• [12] Clinical pipeline report, company report or official report of BlackThorn Therapeutics.
• [13] Wax PM, Becker CE, Curry SC: Unexpected gas casualties in Moscow: a medical toxicology perspective. Ann Emerg Med. 2003 May;41(5):700-5.
• [14] Analgesic efficacy of peripheral kappa-opioid receptor agonist CR665 compared to oxycodone in a multi-modal, multi-tissue experimental human pain model: selective effect on visceral pain. Anesthesiology. 2009 Sep;111(3):616-24.
• [15] Enadoline, a selective kappa-opioid receptor agonist shows potent antihyperalgesic and antiallodynic actions in a rat model of surgical pain. Pain. 1999 Mar;80(1-2):383-9.
• [16] LY2456302 is a novel, potent, orally-bioavailable small molecule kappa-selective antagonist with activity in animal models predictive of efficacy in mood and addictive disorders. Neuropharmacology. 2014 Feb;77:131-44.
• [17] Effect of niravoline (RU51599), a kappa-opioid receptor agonist, on tumour-origin brain oedema. Acta Neurochir (Wien). 1999;141(7):771-8.
• [18] Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2023. Adis Insight
• [19] Syntheses and opioid receptor binding properties of carboxamido-substituted opioids. Bioorg Med Chem Lett. 2009 Jan 1;19(1):203-8.
• [20] Kappa-opioid receptors behind the blood-brain barrier are involved in the anti-hypertensive effects of systemically administered kappa-agonists in the conscious spontaneously hypertensive rat. J Pharm Pharmacol. 1999 Nov;51(11):1251-6.
• [21] US patent application no. 6,924,288, Enantiomerically pure opioid diarylmethylpiperzine and methods of using same.
• [22] Design and discovery of a selective small molecule opioid antagonist (2-methyl-N-((2'-(pyrrolidin-1-ylsulfonyl)biphenyl-4-yl)methyl)propan-1-amine, PF-4455242). J Med Chem. 2011 Aug 25;54(16):5868-77.
• [23] Toward a structure-based model of salvinorin A recognition of the kappa-opioid receptor. J Med Chem. 2008 Mar 27;51(6):1824-30.
• [24] Analgesia from a peripherally active kappa-opioid receptor agonist in patients with chronic pancreatitis. Pain. 2003 Jan;101(1-2):89-95.
• [25] Use of receptor chimeras to identify small molecules with high affinity for the dynorphin A binding domain of the kappa opioid receptor. Bioorg Med Chem Lett. 2008 Jun 15;18(12):3667-71.
• [26] Systemic effects of E-2078, a stabilized dynorphin A(1-8) analog, in rhesus monkeys. Psychopharmacology (Berl). 1999 Apr;143(2):190-6.
• [27] Effects of R-84760, a selective kappa-opioid receptor agonist, on nociceptive reflex in isolated neonatal rat spinal cord. Eur J Pharmacol. 1998 Feb 19;343(2-3):171-7.
• [28] WO patent application no. 2007,0677,14, Treatment of sequelae of psychiatric disorders.
• [29] Emerging drugs for obesity: linking novel biological mechanisms to pharmaceutical pipelines. Expert Opin Emerg Drugs. 2005 Aug;10(3):643-60.
• [30] Investigation of the N-substituent conformation governing potency and mu receptor subtype-selectivity in (+)-(3R, 4R)-dimethyl-4-(3-hydroxyphenyl)p... J Med Chem. 1998 May 21;41(11):1980-90.
• [31] Irritable bowel syndrome neuropharmacology. A review of approved and investigational compounds. J Clin Gastroenterol. 2002 Jul;35(1 Suppl):S58-67.
• [32] [(11)C]-GR89696, a potent kappa opiate receptor radioligand; in vivo binding of the R and S enantiomers. Nucl Med Biol. 2002 Jan;29(1):47-53.
• [33] GR94839, a kappa-opioid agonist with limited access to the central nervous system, has antinociceptive activity. Br J Pharmacol. 1992 Aug;106(4):783-9.
• [34] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 318).
• [35] Design and synthesis of novel delta opioid receptor agonists and their pharmacologies. Bioorg Med Chem Lett. 2009 May 15;19(10):2792-5.
• [36] Synthesis and preliminary in vitro investigation of bivalent ligands containing homo- and heterodimeric pharmacophores at mu, delta, and kappa opio... J Med Chem. 2006 Jan 12;49(1):256-62.
• [37] Bioorg Med Chem Lett. 2007 Jun 1;17(11):3023-7. Epub 2007 Mar 23.Synthesis and structure-activity relationships of 4-hydroxy-4-phenylpiperidines as nociceptin receptor ligands: Part 1.
• [38] Bioorg Med Chem Lett. 2007 Jun 1;17(11):3028-33. Epub 2007 Mar 21.Synthesis and structure-activity relationships of 4-hydroxy-4-phenylpiperidines as nociceptin receptor ligands: Part 2.
• [39] The discovery of tropane derivatives as nociceptin receptor ligands for the management of cough and anxiety. Bioorg Med Chem Lett. 2009 May 1;19(9):2519-23.
• [40] Modification of the furan ring of salvinorin A: identification of a selective partial agonist at the kappa opioid receptor. Bioorg Med Chem. 2009 Feb 1;17(3):1370-80.
• [41] 14 beta-O-cinnamoylnaltrexone and related dihydrocodeinones are mu opioid receptor partial agonists with predominant antagonist activity. J Med Chem. 2009 Mar 26;52(6):1553-7.
• [42] Synthesis and opioid receptor binding affinities of 2-substituted and 3-aminomorphinans: ligands for mu, kappa, and delta opioid receptors. J Med Chem. 2010 Jan 14;53(1):402-18.
• [43] Structural determinants of opioid activity in derivatives of 14-aminomorphinones: effect of substitution in the aromatic ring of cinnamoylaminomorp... J Med Chem. 2006 Aug 24;49(17):5333-8.
• [44] Synthesis and characterizations of novel quinoline derivatives having mixed ligand activities at the kappa and mu receptors: Potential therapeutic ... Bioorg Med Chem. 2009 Aug 15;17(16):5782-90.
• [45] Convenient synthesis and in vitro pharmacological activity of 2-thioanalogs of salvinorins A and B. Bioorg Med Chem Lett. 2007 Apr 15;17(8):2229-32.
• [46] 3-(4-Piperidinyl)indoles and 3-(4-piperidinyl)pyrrolo-[2,3-b]pyridines as ligands for the ORL-1 receptor. Bioorg Med Chem Lett. 2006 Jul 1;16(13):3524-8.
• [47] Discovery of 8-azabicyclo[3.2.1]octan-3-yloxy-benzamides as selective antagonists of the kappa opioid receptor. Part 1. Bioorg Med Chem Lett. 2010 Oct 1;20(19):5847-52.
• [48] Syntheses of novel high affinity ligands for opioid receptors. Bioorg Med Chem Lett. 2009 Apr 15;19(8):2289-94.
• [49] Subramanian G, Paterlini MG, Portoghese PS, Ferguson DM: Molecular docking reveals a novel binding site model for fentanyl at the mu-opioid receptor. J Med Chem. 2000 Feb 10;43(3):381-91.
• [50] You HJ, Colpaert FC, Arendt-Nielsen L: The novel analgesic and high-efficacy 5-HT1A receptor agonist F 13640 inhibits nociceptive responses, wind-up, and after-discharges in spinal neurons and withdrawal reflexes. Exp Neurol. 2005 Jan;191(1):174-83.
• [51] Structure-activity relationship studies of carboxamido-biaryl ethers as opioid receptor antagonists (OpRAs). Part 1. Bioorg Med Chem Lett. 2007 Oct 1;17(19):5349-52.
• [52] Potent, orally bioavailable delta opioid receptor agonists for the treatment of pain: discovery of N,N-diethyl-4-(5-hydroxyspiro[chromene-2,4'-pipe... J Med Chem. 2008 Oct 9;51(19):5893-6.
• [53] Spirocyclic delta opioid receptor agonists for the treatment of pain: discovery of N,N-diethyl-3-hydroxy-4-(spiro[chromene-2,4'-piperidine]-4-yl) b... J Med Chem. 2009 Sep 24;52(18):5685-702.
• [54] 4-Phenyl-4-[1H-imidazol-2-yl]-piperidine derivatives, a novel class of selective delta-opioid agonists. Bioorg Med Chem Lett. 2006 Jan 1;16(1):146-9.
• [55] Structure activity relationship studies of carboxamido-biaryl ethers as opioid receptor antagonists (OpRAs). Part 2. Bioorg Med Chem Lett. 2007 Dec 15;17(24):6841-6.
• [56] Synthesis of analogues of acetylmethadol and methadol as potential narcotic antagonists. J Med Chem. 1981 Jul;24(7):903-6.
• [57] Design, synthesis, and characterization of 6beta-naltrexol analogs, and their selectivity for in vitro opioid receptor subtypes. Bioorg Med Chem Lett. 2009 May 15;19(10):2811-4.
• [58] SAR development of a series of 8-azabicyclo[3.2.1]octan-3-yloxy-benzamides as kappa opioid receptor antagonists. Part 2. Bioorg Med Chem Lett. 2010 Sep 15;20(18):5405-10.
• [59] Redefining the structure-activity relationships of 2,6-methano-3-benzazocines. Part 6: Opioid receptor binding properties of cyclic variants of 8-c... Bioorg Med Chem. 2008 May 15;16(10):5653-64.
• [60] Novel coumarin glycoside and phenethyl vanillate from Notopterygium forbesii and their binding affinities for opioid and dopamine receptors. Bioorg Med Chem. 2008 Mar 15;16(6):3218-23.
• [61] Synthesis and in vitro biological evaluation of a carbon glycoside analogue of morphine-6-glucuronide. Bioorg Med Chem Lett. 2005 Mar 15;15(6):1583-6.
• [62] Beta-endorphin is a potent inhibitor of thymidine incorporation into DNA via mu- and kappa-opioid receptors in fetal rat brain cell aggregates in culture. J Neurochem. 1993 Feb;60(2):765-7.
• [63] Kappa-opioid receptor selectivity for ischemic neuroprotection with BRL 52537 in rats. Anesth Analg. 2003 Dec;97(6):1776-83.
• [64] The antitussive activity of delta-opioid receptor stimulation in guinea pigs. J Pharmacol Exp Ther. 2000 Feb;292(2):803-9.
• [65] Synthesis and opioid receptor affinity of morphinan and benzomorphan derivatives: mixed kappa agonists and mu agonists/antagonists as potential pha... J Med Chem. 2000 Jan 13;43(1):114-22.
• [66] Synthesis of stable and potent delta/mu opioid peptides: analogues of H-Tyr-c[D-Cys-Gly-Phe-D-Cys]-OH by ring-closing metathesis. J Med Chem. 2007 Jun 28;50(13):3138-42.
• [67] Nascent structure-activity relationship study of a diastereomeric series of kappa opioid receptor antagonists derived from CJ-15,208. Bioorg Med Chem Lett. 2009 Jul 1;19(13):3647-50.
• [68] Opiate receptor binding properties of morphine-, dihydromorphine-, and codeine 6-O-sulfate ester congeners. Bioorg Med Chem Lett. 2006 Aug 15;16(16):4291-5.
• [69] Replacement of the N-terminal tyrosine residue in opioid peptides with 3-(2,6-dimethyl-4-carbamoylphenyl)propanoic acid (Dcp) results in novel opio... J Med Chem. 2006 Aug 24;49(17):5382-5.
• [70] Synthesis and in vitro evaluation of salvinorin A analogues: effect of configuration at C(2) and substitution at C(18). Bioorg Med Chem Lett. 2006 Sep 1;16(17):4679-85.
• [71] Opiate receptor binding properties of morphine-, dihydromorphine-, and codeine 6-O-sulfate ester congeners. Bioorg Med Chem Lett. 2006 Aug 15;16(16):4291-5.
• [72] [6-O-methyl-11C]Diprenorphine Molecular Imaging and Contrast Agent Database (MICAD) [Internet].
• [73] Bifunctional [2',6'-dimethyl-L-tyrosine1]endomorphin-2 analogues substituted at position 3 with alkylated phenylalanine derivatives yield potent mi... J Med Chem. 2007 Jun 14;50(12):2753-66.
• [74] Opioid agonist and antagonist activities of morphindoles related to naltrindole. J Med Chem. 1992 Nov 13;35(23):4325-9.
• [75] FK-506-binding protein: three-dimensional structure of the complex with the antagonist L-685,818. J Biol Chem. 1993 May 25;268(15):11335-9.
• [76] Cloning and functional comparison of kappa and delta opioid receptors from mouse brain. Proc Natl Acad Sci U S A. 1993 Jul 15;90(14):6736-40.
• [77] Peptides as receptor selectivity modulators of opiate pharmacophores. J Med Chem. 1986 Jul;29(7):1222-5.
• [78] Synthesis and evaluation of opioid receptor-binding affinity of elaeocarpenine and its analogs. Bioorg Med Chem Lett. 2010 Mar 1;20(5):1601-3.
• [79] Structure-activity study on the Phe side chain arrangement of endomorphins using conformationally constrained analogues. J Med Chem. 2004 Jan 29;47(3):735-43.
• [80] Activation of the cloned human kappa opioid receptor by agonists enhances [35S]GTPgammaS binding to membranes: determination of potencies and efficacies of ligands. J Pharmacol Exp Ther. 1997 Aug;282(2):676-84.
• [81] Photoactivatable opiate derivatives as irreversible probes of the mu-opioid receptor. J Med Chem. 1990 Sep;33(9):2456-64.
• [82] A series of novel, highly potent and selective agonists for the kappa-opioid receptor. Br J Pharmacol. 1990 Dec;101(4):944-8.
• [83] J. Med. Chem. 1993,36, 2075-2083
• [84] Neuroprotective actions of GR89696, a highly potent and selective kappa-opioid receptor agonist.
• [85] Further studies of tyrosine surrogates in opioid receptor peptide ligands. Bioorg Med Chem Lett. 2007 May 1;17(9):2656-60.
• [86] Dicarba analogues of the cyclic enkephalin peptides H-Tyr-c[D-Cys-Gly-Phe-D(or L)-Cys]NH(2) retain high opioid activity. J Med Chem. 2007 Mar 22;50(6):1414-7.
• [87] Herkinorin analogues with differential beta-arrestin-2 interactions. J Med Chem. 2008 Apr 24;51(8):2421-31.
• [88] The effects of C-terminal modifications on the opioid activity of [N-benzylTyr(1)]dynorphin A-(1-11) analogues. J Med Chem. 2009 Nov 12;52(21):6814-21.
• [89] Arylacetamide-derived fluorescent probes: synthesis, biological evaluation, and direct fluorescent labeling of kappa opioid receptors in mouse micr... J Med Chem. 1996 Apr 12;39(8):1729-35.
• [90] ICI 204448: a kappa-opioid agonist with limited access to the CNS.
• [91] Potential affinity labels for the opiate receptor based on fentanyl and related compounds. J Med Chem. 1982 Aug;25(8):913-9.
• [92] 14beta-Arylpropiolylamino-17-cyclopropylmethyl-7,8-dihydronormorphinones and related opioids. Further examples of pseudoirreversible mu opioid rece... J Med Chem. 2009 Nov 12;52(21):6926-30.
• [93] Univalent and bivalent ligands of butorphan: characteristics of the linking chain determine the affinity and potency of such opioid ligands. J Med Chem. 2009 Dec 10;52(23):7389-96.
• [94] In-vitro investigation of oxazol and urea analogues of morphinan at opioid receptors. Bioorg Med Chem. 2007 Jun 15;15(12):4106-12.
• [95] Effect of linker substitution on the binding of butorphan univalent and bivalent ligands to opioid receptors. Bioorg Med Chem Lett. 2010 Mar 1;20(5):1507-9.
• [96] High-affinity carbamate analogues of morphinan at opioid receptors. Bioorg Med Chem Lett. 2007 Mar 15;17(6):1508-11.
• [97] New opioid designed multiple ligand from Dmt-Tic and morphinan pharmacophores. J Med Chem. 2006 Sep 7;49(18):5640-3.
• [98] Identification of MK-1925: a selective, orally active and brain-penetrable opioid receptor-like 1 (ORL1) antagonist. Bioorg Med Chem Lett. 2009 Aug 15;19(16):4729-32.
• [99] Morphinan cyclic imines and pyrrolidines containing a constrained phenyl group: High affinity opioid agonists, Bioorg. Med. Chem. Lett. 5(24):2969-2974 (1995).
• [100] Electrophilic gamma-lactone kappa-opioid receptor probes. Analogues of 2'-hydroxy-2-tetrahydrofurfuryl-5,9-dimethyl-6,7-benzomorphan diastereomers. J Med Chem. 1991 Aug;34(8):2438-44.
• [101] Synthesis and opioid activity of [D-Pro10]dynorphin A-(1-11) analogues with N-terminal alkyl substitution. J Med Chem. 1997 Aug 15;40(17):2733-9.
• [102] Synthesis of N-isobutylnoroxymorphone from naltrexone by a selective cyclopropane ring opening reaction. Bioorg Med Chem Lett. 2008 Sep 15;18(18):4978-81.
• [103] Apparent efficacy of kappa-opioid receptor ligands on serum prolactin levels in rhesus monkeys. Eur J Pharmacol. 1999 Nov 3;383(3):305-9.
• [104] Synthesis of pyrrolomorphinan derivatives as kappa opioid agonists. Bioorg Med Chem Lett. 2010 Sep 1;20(17):5035-8.
• [105] Ligand binding to nucleic acids and proteins: Does selectivity increase with strength Eur J Med Chem. 2008 Nov;43(11):2307-15.
• [106] Probes for narcotic receptor mediated phenomena. 34. Synthesis and structure-activity relationships of a potent mu-agonist delta-antagonist and an ... J Med Chem. 2007 Aug 9;50(16):3765-76.
• [107] Synthetic studies of neoclerodane diterpenes from Salvia divinorum: preparation and opioid receptor activity of salvinicin analogues. J Med Chem. 2007 Jul 26;50(15):3596-603.
• [108] Standard protecting groups create potent and selective kappa opioids: salvinorin B alkoxymethyl ethers. Bioorg Med Chem. 2008 Feb 1;16(3):1279-86.
• [109] Design and synthesis of KNT-127, a -opioid receptor agonist effective by systemic administration. Bioorg Med Chem Lett. 2010 Nov 1;20(21):6302-5.
• [110] Aerobic oxidation of indolomorphinan without the 4,5-epoxy bridge and subsequent rearrangement of the oxidation product to spiroindolinonyl-C-normo... Bioorg Med Chem. 2009 Aug 15;17(16):5983-8.
• [111] The selective kappa-opioid receptor agonist U50,488H attenuates voluntary ethanol intake in the rat. Behav Brain Res. 2001 May;120(2):137-46.
• [112] kappa-Opioid receptor in humans: cDNA and genomic cloning, chromosomal assignment, functional expression, pharmacology, and expression pattern in the central nervous system. Proc Natl Acad Sci U S A.1995 Jul 18;92(15):7006-10.
• [113] [3H]U-69593 a highly selective ligand for the opioid kappa receptor. Eur J Pharmacol. 1985 Feb 26;109(2):281-4.
• [114] Carba-analogues of fentanyl are opioid receptor agonists. J Med Chem. 2010 Apr 8;53(7):2875-81.
• [115] NMR studies of an FK-506 analog, [U-13C]ascomycin, bound to FK-506-binding protein. J Med Chem. 1992 Jun 26;35(13):2467-73.