General Information of Drug Therapeutic Target (DTT) (ID: TTS2PH3)

DTT Name Dopamine D5 receptor (D5R)
Synonyms Dopamine receptor 5; DRD5; D1beta dopamine receptor; D(5)D(1B) dopamine receptor dopamine receptor; D(5) dopamine receptor
Gene Name DRD5
DTT Type
Successful target
[1]
BioChemical Class
GPCR rhodopsin
UniProt ID
DRD5_HUMAN
TTD ID
T46828
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MLPPGSNGTAYPGQFALYQQLAQGNAVGGSAGAPPLGPSQVVTACLLTLLIIWTLLGNVL
VCAAIVRSRHLRANMTNVFIVSLAVSDLFVALLVMPWKAVAEVAGYWPFGAFCDVWVAFD
IMCSTASILNLCVISVDRYWAISRPFRYKRKMTQRMALVMVGLAWTLSILISFIPVQLNW
HRDQAASWGGLDLPNNLANWTPWEEDFWEPDVNAENCDSSLNRTYAISSSLISFYIPVAI
MIVTYTRIYRIAQVQIRRISSLERAAEHAQSCRSSAACAPDTSLRASIKKETKVLKTLSV
IMGVFVCCWLPFFILNCMVPFCSGHPEGPPAGFPCVSETTFDVFVWFGWANSSLNPVIYA
FNADFQKVFAQLLGCSHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTP
GNREVDNDEEEGPFDRMFQIYQTSPDGDPVAESVWELDCEGEISLDKITPFTPNGFH
Function Dopamine receptor whose activity is mediated by G proteins which activate adenylyl cyclase.
KEGG Pathway
Calcium signaling pathway (hsa04020 )
cAMP signaling pathway (hsa04024 )
Neuroactive ligand-receptor interaction (hsa04080 )
Dopaminergic synapse (hsa04728 )
Reactome Pathway
G alpha (s) signalling events (R-HSA-418555 )
Dopamine receptors (R-HSA-390651 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
1 Approved Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
Phenyltoloxamine DMKAEQW Allergy 4A80-4A85 Approved [1]
------------------------------------------------------------------------------------
1 Preclinical Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
LE-300 DMGJL16 Schizophrenia 6A20 Preclinical [2]
------------------------------------------------------------------------------------
2 Discontinued Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
GMC-283 DMT1RH6 Schizophrenia 6A20 Terminated [2]
ZD-3638 DM6M9GC Schizophrenia 6A20 Terminated [2]
------------------------------------------------------------------------------------
17 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
(+)-ADTN DMXWCVY Discovery agent N.A. Investigative [3]
(+/-)-nantenine DM0L3GE Discovery agent N.A. Investigative [4]
1-(4-(4-phenyl-1-piperazinyl)butyl)indolin-2-one DMM18AQ Discovery agent N.A. Investigative [5]
1-Dibenzo[b,f]oxepin-10-yl-4-methyl-piperazine DMOL2Y0 Discovery agent N.A. Investigative [6]
1-[2-(2-Benzyl-phenoxy)-ethyl]-piperidine DMTNRG7 Discovery agent N.A. Investigative [1]
1-[2-(2-Benzyl-phenoxy)-ethyl]-pyrrolidine DMLSU30 Discovery agent N.A. Investigative [1]
1-[3-(2-Benzyl-phenoxy)-propyl]-pyrrolidine DMD2NXL Discovery agent N.A. Investigative [1]
4-[2-(2-Benzyl-phenoxy)-ethyl]-morpholine DM08CG7 Discovery agent N.A. Investigative [1]
beta-ergocriptine DMU3YXR Discovery agent N.A. Investigative [3]
FLUMEZAPINE DMW0HOG Discovery agent N.A. Investigative [7]
FLUTROLINE DMUOHVL Discovery agent N.A. Investigative [8]
ISOCLOZAPINE DM52CPU Discovery agent N.A. Investigative [6]
ISOLOXAPINE DMH1BN4 Discovery agent N.A. Investigative [9]
N-propylnorapomorphine DMO7MTX N. A. N. A. Investigative [3]
SKF-83556 DMCMQH8 Discovery agent N.A. Investigative [3]
STEPHOLIDINE DMGMXQC Discovery agent N.A. Investigative [10]
[125I]SCH23982 DM06S9X Discovery agent N.A. Investigative [11]
------------------------------------------------------------------------------------
⏷ Show the Full List of 17 Investigative Drug(s)

Molecular Expression Atlas (MEA) of This DTT

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DTT
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Schizophrenia 6A20 Pre-frontal cortex 2.59E-01 -0.06 -0.18
Schizophrenia 6A20 Superior temporal cortex 8.63E-01 -0.01 -0.08
Type 2 diabetes 5A11 Liver tissue 1.52E-01 -0.14 -1.07
------------------------------------------------------------------------------------

References

1 Dopamine/serotonin receptor ligands. 9. Oxygen-containing midsized heterocyclic ring systems and nonrigidized analogues. A step toward dopamine D5 ... J Med Chem. 2004 Aug 12;47(17):4155-8.
2 The pipeline and future of drug development in schizophrenia. Mol Psychiatry. 2007 Oct;12(10):904-22.
3 Cloning of the gene for a human dopamine D5 receptor with higher affinity for dopamine than D1. Nature. 1991 Apr 18;350(6319):614-9.
4 Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine. Bioorg Med Chem Lett. 2010 Jan 15;20(2):628-31.
5 Synthesis of novel lactam derivatives and their evaluation as ligands for the dopamine receptors, leading to a D(4)-selective ligand. Bioorg Med Chem. 2007 Sep 1;15(17):5811-8.
6 Affinity of 10-(4-methylpiperazino)dibenz[b,f]oxepins for clozapine and spiroperidol binding sites in rat brain. J Med Chem. 1982 Jul;25(7):855-8.
7 Effects of conformationally restricted 4-piperazinyl-10H-thienobenzodiazepine neuroleptics on central dopaminergic and cholinergic systems. J Med Chem. 1982 Oct;25(10):1133-40.
8 Neuroleptic activity in 5-aryltetrahydro-gamma-carbolines. J Med Chem. 1980 Jun;23(6):635-43.
9 Synthesis of clozapine analogues and their affinity for clozapine and spiroperidol binding sites in rat brain. J Med Chem. 1981 Sep;24(9):1021-6.
10 Dibenzazecine scaffold rebuilding--is the flexibility always essential for high dopamine receptor affinities Bioorg Med Chem. 2009 Oct 1;17(19):6898-907.
11 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 218).