Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTTJF7V)

• DTT Name: NADH dehydrogenase (MT-ND3)
• Synonyms: ND; NADH-ubiquinone oxidoreductase; NADH; MTND; MT-ND3; MT-ND
• Gene Name: MT-ND3
• DTT Type: Successful target; [1]
• BioChemical Class: NADH/NADPH oxidoreductase
• UniProt ID: NU3M_HUMAN
• TTD ID: T77195
• EC Number: EC 7.1.1.2
• Sequence:
  MNFALILMINTLLALLLMIITFWLPQLNGYMEKSTPYECGFDPMSPARVPFSMKFFLVAI
  TFLLFDLEIALLLPLPWALQTTNLPLMVMSSLLLIIILALSLAYEWLQKGLDWTE
• Function: Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in thetransfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
• KEGG Pathway:
  Oxidative phosphorylation (hsa00190)
  Metabolic pathways (hsa01100)
  Parkinson's disease (hsa05012)
• Reactome Pathway:
  Complex I biogenesis (R-HSA-6799198)
  Respiratory electron transport (R-HSA-611105)
• BioCyc Pathway: MetaCyc:HS00032-MON

Molecular Interaction Atlas (MIA) of This DTT

1 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
NADH	DM5NM6E	Parkinson disease	8A00.0	Approved	[1]

3 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
6-Thiophen-2-yl-imidazo[2,1-b]thiazole	DMC013U	Discovery agent	N.A.	Investigative	[2]
6-Thiophen-3-yl-imidazo[2,1-b]thiazole	DM90VJ6	Discovery agent	N.A.	Investigative	[2]
N-Formylmethionine	DM7GBDX	Discovery agent	N.A.	Investigative	[3]

References

• [1] Mechanism of cadmium-decreased glucuronidation in the rat. Biochem Pharmacol. 1992 Dec 1;44(11):2139-47.
• [2] Thienylimidazo[2,1-b]thiazoles as inhibitors of mitochondrial NADH dehydrogenase. J Med Chem. 1995 Mar 31;38(7):1090-7.
• [3] How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.