Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTU5A6Q)

• DTT Name: Adenine nucleotide translocator 1 (SLC25A4)
• Synonyms: Solute carrier family 25 member 4; SLC25A4; ANT1; ANT 1; ADP/ATP translocase 1; ADP,ATP carrier protein, heart/skeletal muscle isoform T1; ADP,ATP carrier protein 1
• Gene Name: SLC25A4
• DTT Type: Successful target; [1]
• BioChemical Class: Mitochondrial carrier
• UniProt ID: ADT1_HUMAN
• TTD ID: T68461
• Sequence:
  MGDHAWSFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVR
  IPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDRHKQFWRYFAGNLASG
  GAAGATSLCFVYPLDFARTRLAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQGFNVS
  VQGIIIYRAAYFGVYDTAKGMLPDPKNVHIFVSWMIAQSVTAVAGLVSYPFDTVRRRMMM
  QSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV
• Function: Catalyzes the exchange of cytoplasmic ADP with mitochondrial ATP across the mitochondrial inner membrane.
• KEGG Pathway:
  Calcium signaling pathway (hsa04020)
  cGMP-PKG signaling pathway (hsa04022)
  Parkinson's disease (hsa05012)
  Huntington's disease (hsa05016)
  HTLV-I infection (hsa05166)
• Reactome Pathway:
  Regulation of insulin secretion (R-HSA-422356)
  Mitochondrial protein import (R-HSA-1268020)

Molecular Interaction Atlas (MIA) of This DTT

1 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Clodronate	DM9Y6X7	Hypercalcaemia	5B91.0	Approved	[1]

4 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
bongkrek acid	DMWALXQ	Discovery agent	N.A.	Investigative	[2]
Carboxyatractyloside	DMEORTQ	Discovery agent	N.A.	Investigative	[3]
Cardiolipin	DMCSMX4	Discovery agent	N.A.	Investigative	[4]
Di-Stearoyl-3-Sn-Phosphatidylcholine	DM0GQJ2	Discovery agent	N.A.	Investigative	[3]

The Drug Transporter (DTP) Role of This DTT

• DTT DTP Name: Adenine nucleotide translocator 1 (SLC25A4) DTP Info
• Gene Name: SLC25A4

References

• [1] Further insight into mechanism of action of clodronate: inhibition of mitochondrial ADP/ATP translocase by a nonhydrolyzable, adenine-containing metabolite. Mol Pharmacol. 2002 May;61(5):1255-62.
• [2] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 1062).
• [3] How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
• [4] DrugBank 3.0: a comprehensive resource for 'omics' research on drugs. Nucleic Acids Res. 2011 Jan;39(Database issue):D1035-41.