Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTVBPDM)

• DTT Name: Metabotropic glutamate receptor 1 (mGluR1)
• Synonyms: mGLUR1; Glutamate receptor mGLU1; GPRC1A
• Gene Name: GRM1
• DTT Type: Discontinued target; [1]
• BioChemical Class: GPCR glutamate
• UniProt ID: GRM1_HUMAN
• TTD ID: T27137
• Sequence:
  MVGLLLFFFPAIFLEVSLLPRSPGRKVLLAGASSQRSVARMDGDVIIGALFSVHHQPPAE
  KVPERKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSI
  EFIRDSLISIRDEKDGINRCLPDGQSLPPGRTKKPIAGVIGPGSSSVAIQVQNLLQLFDI
  PQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESG
  MDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLL
  SAMRRLGVVGEFSLIGSDGWADRDEVIEGYEVEANGGITIKLQSPEVRSFDDYFLKLRLD
  TNTRNPWFPEFWQHRFQCRLPGHLLENPNFKRICTGNESLEENYVQDSKMGFVINAIYAM
  AHGLQNMHHALCPGHVGLCDAMKPIDGSKLLDFLIKSSFIGVSGEEVWFDEKGDAPGRYD
  IMNLQYTEANRYDYVHVGTWHEGVLNIDDYKIQMNKSGVVRSVCSEPCLKGQIKVIRKGE
  VSCCWICTACKENEYVQDEFTCKACDLGWWPNADLTGCEPIPVRYLEWSNIESIIAIAFS
  CLGILVTLFVTLIFVLYRDTPVVKSSSRELCYIILAGIFLGYVCPFTLIAKPTTTSCYLQ
  RLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVIIASILISVQLTL
  VVTLIIMEPPMPILSYPSIKEVYLICNTSNLGVVAPLGYNGLLIMSCTYYAFKTRNVPAN
  FNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITTCFAVSLSVTVALGCMFTPKMYIIIA
  KPERNVRSAFTTSDVVRMHVGDGKLPCRSNTFLNIFRRKKAGAGNANSNGKSVSWSEPGG
  GQVPKGQHMWHRLSVHVKTNETACNQTAVIKPLTKSYQGSGKSLTFSDTSTKTLYNVEEE
  EDAQPIRFSPPGSPSMVVHRRVPSAATTPPLPSHLTAEETPLFLAEPALPKGLPPPLQQQ
  QQPPPQQKSLMDQLQGVVSNFSTAIPDFHAVLAGPGGPGNGLRSLYPPPPPPQHLQMLPL
  QLSTFGEELVSPPADDDDDSERFKLLQEYVYEHEREGNTEEDELEEEEEDLQAASKLTPD
  DSPALTPPSPFRDSVASGSSVPSSPVSESVLCTPPNVSYASVILRDYKQSSSTL
• Function: Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Signaling activates a phosphatidylinositol-calcium second messenger system. May participate in the central action of glutamate in the CNS, such as long-term potentiation in the hippocampus and long-term depression in the cerebellum. G-protein coupled receptor for glutamate.
• KEGG Pathway:
  Calcium signaling pathway (hsa04020)
  FoxO signaling pathway (hsa04068)
  Neuroactive ligand-receptor interaction (hsa04080)
  Gap junction (hsa04540)
  Long-term potentiation (hsa04720)
  Retrograde endocannabinoid signaling (hsa04723)
  Glutamatergic synapse (hsa04724)
  Long-term depression (hsa04730)
  Estrogen signaling pathway (hsa04915)
• Reactome Pathway:
  Class C/3 (Metabotropic glutamate/pheromone receptors) (R-HSA-420499)
  G alpha (q) signalling events (R-HSA-416476)

Molecular Interaction Atlas (MIA) of This DTT

4 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
PF-1913539	DMXEU14	Alzheimer disease	8A20	Discontinued in Phase 3	[2]
AZD8529	DMEQ2N1	Schizophrenia	6A20	Discontinued in Phase 2	[3]
AZD-9272	DMYSBN3	Neuropathic pain	8E43.0	Discontinued in Phase 1	[4]
LY-367385	DM98POQ	Neurological disorder	6B60	Terminated	[6]

2 Preclinical Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
A-841720	DMSO8IE	Pain	MG30-MG3Z	Preclinical	[1]
NPS-2390	DMMRY0Z	Cerebrovascular ischaemia	8B1Z	Preclinical	[5]

84 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(+)-MCPG	DMG5QJB	Discovery agent	N.A.	Investigative	[7]
(1S,3R)-ACPD	DM5DOAF	Discovery agent	N.A.	Investigative	[8]
(3,4-dimethylphenyl)(4-phenoxyphenyl)methanone	DMAF43E	Discovery agent	N.A.	Investigative	[9]
(E)-1-Adamantan-1-yl-3-quinolin-3-yl-propenone	DMQ9TWD	Discovery agent	N.A.	Investigative	[9]
(E)-4,4-Dimethyl-1-quinolin-3-yl-pent-1-en-3-one	DMJGAFV	Discovery agent	N.A.	Investigative	[9]
(S)-(+)-CBPG	DMPDOY8	Discovery agent	N.A.	Investigative	[10]
(S)-3HPG	DMQ0FVJ	Discovery agent	N.A.	Investigative	[8]
(S)-4C3HPG	DMQK4I2	Discovery agent	N.A.	Investigative	[8]
(S)-4CPG	DMZ9UIL	Discovery agent	N.A.	Investigative	[7]
(S)-TBPG	DM68XFZ	Discovery agent	N.A.	Investigative	[11]
2-methyl-6-(phenylethynyl)pyridine	DMVQK4Y	Discovery agent	N.A.	Investigative	[12]
3,5-DHPG	DMFEQ6S	Discovery agent	N.A.	Investigative	[7]
3,5-dimethyl PPP	DM3E98I	Discovery agent	N.A.	Investigative	[13]
3-MATIDA	DMRMF13	Discovery agent	N.A.	Investigative	[14]
4-(cyclohexyloxy)quinazoline	DMCDZ7E	Discovery agent	N.A.	Investigative	[15]
6-bromo-N-(3-chlorophenyl)quinazolin-4-amine	DM0A3DB	Discovery agent	N.A.	Investigative	[16]
A-794278	DM6BRTF	Discovery agent	N.A.	Investigative	[17]
A-794282	DMU965M	Discovery agent	N.A.	Investigative	[17]
A-850002	DMJCPSD	Discovery agent	N.A.	Investigative	[17]
AIDA	DM3LCDK	Discovery agent	N.A.	Investigative	[7]
BAY 367620	DMVP74I	Discovery agent	N.A.	Investigative	[18]
CFMMC	DMN8B1S	Discovery agent	N.A.	Investigative	[19]
CFMTI	DM9HMP4	Discovery agent	N.A.	Investigative	[20]
CPCCOEt	DMI4WVE	Discovery agent	N.A.	Investigative	[7]
DM-PPP	DMUGPD1	Discovery agent	N.A.	Investigative	[13]
FPTQ	DMR2NBK	Discovery agent	N.A.	Investigative	[21]
FTIDC	DM65VLB	Discovery agent	N.A.	Investigative	[22]
ibotenate	DM8RZE0	Discovery agent	N.A.	Investigative	[8]
JNJ-16567083	DMXNFU5	Discovery agent	N.A.	Investigative	[23]
L-CCG-I	DMPZ8XH	Discovery agent	N.A.	Investigative	[8]
LY-3390334	DMUXFZQ	Discovery agent	N.A.	Investigative	[24]
LY456066	DM86Y1V	Discovery agent	N.A.	Investigative	[19]
LY456236	DMROFX8	Discovery agent	N.A.	Investigative	[25]
MK-5435	DMU8VRB	Discovery agent	N.A.	Investigative	[26]
N-(2,3-dihydro-1H-inden-2-yl)isoquinolin-1-amine	DMTLPDZ	Discovery agent	N.A.	Investigative	[15]
N-(2,3-dihydro-1H-inden-2-yl)quinazolin-4-amine	DMJ6LI8	Discovery agent	N.A.	Investigative	[15]
N-(2-methyl-2-phenylpropyl)pyrazine-2-carboxamide	DMXRSM1	Discovery agent	N.A.	Investigative	[27]
N-(2-phenylpropyl)quinoxaline-2-carboxamide	DMA1LRF	Discovery agent	N.A.	Investigative	[27]
N-(3-bromophenyl)-6-chloroquinazolin-4-amine	DMEWQCN	Discovery agent	N.A.	Investigative	[16]
N-(3-bromophenyl)-6-fluoroquinazolin-4-amine	DMRIK7P	Discovery agent	N.A.	Investigative	[16]
N-cyclohexylquinazolin-4-amine	DMJ0T3W	Discovery agent	N.A.	Investigative	[15]
N-cyclohexylquinolin-4-amine	DMJY2PA	Discovery agent	N.A.	Investigative	[15]
N-phenethylquinoxaline-2-carboxamide	DM1ZPGY	Discovery agent	N.A.	Investigative	[27]
PHCCC	DMNJY79	Discovery agent	N.A.	Investigative	[25]
PMID12470711C3	DM1ISJU	Discovery agent	N.A.	Investigative	[13]
PMID16099654C3a	DMIRSWL	Discovery agent	N.A.	Investigative	[28]
PMID16099654C4b	DMV8UK1	Discovery agent	N.A.	Investigative	[28]
PMID17064898C29	DMITDEB	Discovery agent	N.A.	Investigative	[27]
PMID17276684C22	DMWNYBV	Discovery agent	N.A.	Investigative	[29]
PMID17532216C2f	DMX3CYG	Discovery agent	N.A.	Investigative	[30]
PMID17929793C11c	DMDVW4K	Discovery agent	N.A.	Investigative	[31]
PMID17929793C23c	DMIG308	Discovery agent	N.A.	Investigative	[31]
PMID17929793C23e	DMOB07W	Discovery agent	N.A.	Investigative	[31]
PMID17929793C23h	DM83Z6M	Discovery agent	N.A.	Investigative	[31]
PMID17929793C23i	DM07TVS	Discovery agent	N.A.	Investigative	[31]
PMID19289283C22	DMJRLB5	Discovery agent	N.A.	Investigative	[15]
PMID19289283C32	DMSKGEJ	Discovery agent	N.A.	Investigative	[15]
PMID19433355C11q	DMPXEIQ	Discovery agent	N.A.	Investigative	[32]
PMID19433355C11s	DMBU0XJ	Discovery agent	N.A.	Investigative	[32]
PMID20346665C24	DMLKFTE	Discovery agent	N.A.	Investigative	[33]
PMID20346665C27	DMDKW6G	Discovery agent	N.A.	Investigative	[33]
PMID22266036C12e	DM4NRG5	Discovery agent	N.A.	Investigative	[34]
PMID22266036C9a	DMFQHVL	Discovery agent	N.A.	Investigative	[34]
PMID23084894C10i	DMURP5Y	Discovery agent	N.A.	Investigative	[35]
PMID23084894C9n	DM4ATLM	Discovery agent	N.A.	Investigative	[35]
Pyrazine-2-carboxylic acid adamantan-1-ylamide	DMIZB81	Discovery agent	N.A.	Investigative	[5]
Quinoline-2-carboxylic acid adamantan-1-ylamide	DMDY3I2	Discovery agent	N.A.	Investigative	[5]
Quinoline-3-carboxylic acid adamantan-1-ylamide	DM9BIVL	Discovery agent	N.A.	Investigative	[5]
R214127	DMX80BL	Discovery agent	N.A.	Investigative	[7]
Ro01-6128	DM0AC84	Discovery agent	N.A.	Investigative	[36]
Ro0711401	DMZLUAK	Discovery agent	N.A.	Investigative	[37]
Ro67-4853	DMD93NP	Discovery agent	N.A.	Investigative	[36]
Ro67-7476	DMI95DP	Discovery agent	N.A.	Investigative	[36]
VU-71	DMHX1KJ	Discovery agent	N.A.	Investigative	[28]
VU0080241	DMUMOV1	Discovery agent	N.A.	Investigative	[38]
VU0469650	DM1H5DL	Discovery agent	N.A.	Investigative	[39]
YM-202074	DM3IOLR	Discovery agent	N.A.	Investigative	[40]
YM298198	DMUYDXT	Discovery agent	N.A.	Investigative	[41]
[11C]MMTP	DMQRSP7	Discovery agent	N.A.	Investigative	[42]
[18F]FITM	DM4VQNE	Discovery agent	N.A.	Investigative	[43]
[18F]FPIT	DMRQ6XD	Discovery agent	N.A.	Investigative	[44]
[18F]MK-1312	DMQ6AR5	Discovery agent	N.A.	Investigative	[26]
[3H]EM-TBPC	DMM1KBW	Discovery agent	N.A.	Investigative	[45]
[3H]quisqualate	DMDQBTX	Discovery agent	N.A.	Investigative	[45]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Schizophrenia	6A20	Pre-frontal cortex	2.31E-01	-0.05	-0.2
Schizophrenia	6A20	Superior temporal cortex	2.46E-02	0.11	0.74

References

• [1] Comparison of the mGluR1 antagonist A-841720 in rat models of pain and cognition. Behav Pharmacol. 2007 Jul;18(4):273-81.
• [2] Pfizer. Product Development Pipeline. March 31 2009.
• [3] Clinical pipeline report, company report or official report of AstraZeneca (2009).
• [4] Emerging drugs in neuropathic pain. Expert Opin Emerg Drugs. 2007 Mar;12(1):113-26.
• [5] Positive and negative modulation of group I metabotropic glutamate receptors. J Med Chem. 2008 Feb 14;51(3):634-47.
• [6] Anticonvulsant actions of LY 367385 ((+)-2-methyl-4-carboxyphenylglycine) and AIDA ((RS)-1-aminoindan-1,5-dicarboxylic acid). Eur J Pharmacol. 1999 Feb 26;368(1):17-24.
• [7] [3H]R214127: a novel high-affinity radioligand for the mGlu1 receptor reveals a common binding site shared by multiple allosteric antagonists. Mol Pharmacol. 2003 May;63(5):1082-93.
• [8] Characterization of [(3)H]Quisqualate binding to recombinant rat metabotropic glutamate 1a and 5a receptors and to rat and human brain sections. J Neurochem. 2000 Dec;75(6):2590-601.
• [9] Synergism of virtual screening and medicinal chemistry: identification and optimization of allosteric antagonists of metabotropic glutamate recepto... Bioorg Med Chem. 2009 Aug 1;17(15):5708-15.
• [10] Biochemical and electrophysiological studies on (S)-(+)-2-(3'-carboxybicyclo(1.1.1)pentyl)-glycine (CBPG), a novel mGlu5 receptor agonist endowed with mGlu1 receptor antagonist activity. Neuropharmacology. 1999 Jul;38(7):917-26.
• [11] Synthesis and biological evaluation of 2-(3'-(1H-tetrazol-5-yl) bicyclo[1.1.1]pent-1-yl)glycine (S-TBPG), a novel mGlu1 receptor antagonist. Bioorg Med Chem. 2001 Feb;9(2):221-7.
• [12] Carbamoyloximes as novel non-competitive mGlu5 receptor antagonists. Bioorg Med Chem Lett. 2010 Aug 1;20(15):4371-5.
• [13] Synthesis and pharmacological characterisation of 2,4-dicarboxy-pyrroles as selective non-competitive mGluR1 antagonists. Bioorg Med Chem. 2003 Jan 17;11(2):171-83.
• [14] The novel and systemically active metabotropic glutamate 1 (mGlu1) receptor antagonist 3-MATIDA reduces post-ischemic neuronal death. Neuropharmacology. 2002 May;42(6):741-51.
• [15] In vitro and in vivo SAR of pyrido[3,4-d]pyramid-4-ylamine based mGluR1 antagonists. Bioorg Med Chem Lett. 2009 Apr 15;19(8):2190-4.
• [16] Discovery and SAR of 6-substituted-4-anilinoquinazolines as non-competitive antagonists of mGlu5. Bioorg Med Chem Lett. 2009 Dec 1;19(23):6623-6.
• [17] Structure-activity relationship of triazafluorenone derivatives as potent and selective mGluR1 antagonists. J Med Chem. 2005 Nov 17;48(23):7374-88.
• [18] BAY36-7620: a potent non-competitive mGlu1 receptor antagonist with inverse agonist activity. Mol Pharmacol. 2001 May;59(5):965-73.
• [19] Identification of a novel transmembrane domain involved in the negative modulation of mGluR1 using a newly discovered allosteric mGluR1 antagonist, 3-cyclohexyl-5-fluoro-6-methyl-7-(2-morpholin-4-ylethoxy)-4H-chromen-4-one. Neuropharmacology. 2009 Sep;57(4):438-45.
• [20] Unique antipsychotic activities of the selective metabotropic glutamate receptor 1 allosteric antagonist 2-cyclopropyl-5-[1-(2-fluoro-3-pyridinyl)-5-methyl-1H-1,2,3-triazol-4-yl]-2,3-dihydro-1H-isoindol-1-one. J Pharmacol Exp Ther. 2009 Jul;330(1):179-90.
• [21] Synthesis and evaluation of 6-[1-(2-[(18)F]fluoro-3-pyridyl)-5-methyl-1H-1,2,3-triazol-4-yl]quinoline for positron emission tomography imaging of the metabotropic glutamate receptor type 1 in brain. Bioorg Med Chem. 2011 Jan 1;19(1):102-10.
• [22] Pharmacological characterization of a new, orally active and potent allosteric metabotropic glutamate receptor 1 antagonist, 4-[1-(2-fluoropyridin-... J Pharmacol Exp Ther. 2007 Jun;321(3):1144-53.
• [23] A positron emission tomography radioligand for the in vivo labeling of metabotropic glutamate 1 receptor: (3-ethyl-2-[11C]methyl-6-quinolinyl)(cis- 4-methoxycyclohexyl)methanone. J Med Chem. 2005 Aug11;48(16):5096-9.
• [24] Inhibition of group I metabotropic glutamate receptor responses in vivo in rats by a new generation of carboxyphenylglycine-like amino acid antagon... Neurosci Lett. 2002 Sep 20;330(2):127-30.
• [25] URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 289).
• [26] Synthesis, characterization, and monkey PET studies of [ ]MK-1312, a PET tracer for quantification of mGluR1 receptor occupancy by MK-5435. Synapse. 2011 Feb;65(2):125-35.
• [27] Structure-activity relationships of novel non-competitive mGluR1 antagonists: a potential treatment for chronic pain. Bioorg Med Chem Lett. 2007 Jan 15;17(2):486-90.
• [28] 9H-Xanthene-9-carboxylic acid [1,2,4]oxadiazol-3-yl- and (2H-tetrazol-5-yl)-amides as potent, orally available mGlu1 receptor enhancers. Bioorg Med Chem Lett. 2005 Oct 15;15(20):4628-31.
• [29] From pyrroles to 1-oxo-2,3,4,9-tetrahydro-1H-beta-carbolines: a new class of orally bioavailable mGluR1 antagonists. Bioorg Med Chem Lett. 2007 Apr 15;17(8):2254-9.
• [30] Rapid hit to lead evaluation of pyrazolo[3,4-d]pyrimidin-4-one as selective and orally bioavailable mGluR1 antagonists. Bioorg Med Chem Lett. 2007 Aug 1;17(15):4303-7.
• [31] Discovery of orally efficacious tetracyclic metabotropic glutamate receptor 1 (mGluR1) antagonists for the treatment of chronic pain. J Med Chem. 2007 Nov 15;50(23):5550-3.
• [32] Tricyclic thienopyridine-pyrimidones/thienopyrimidine-pyrimidones as orally efficacious mGluR1 antagonists for neuropathic pain. Bioorg Med Chem Lett. 2009 Jun 15;19(12):3199-203.
• [33] A-ring modifications on the triazafluorenone core structure and their mGluR1 antagonist properties. Bioorg Med Chem Lett. 2010 Apr 15;20(8):2474-7.
• [34] Fused tricyclic mGluR1 antagonists for the treatment of neuropathic pain. Bioorg Med Chem Lett. 2012 Feb 15;22(4):1575-8.
• [35] Synthesis and SAR development of novel mGluR1 antagonists for the treatment of chronic pain. Bioorg Med Chem Lett. 2012 Dec 1;22(23):7223-6.
• [36] Positive allosteric modulators of metabotropic glutamate 1 receptor: characterization, mechanism of action, and binding site. Proc Natl Acad Sci U S A. 2001 Nov 6;98(23):13402-7.
• [37] Fluorinated 9H-xanthene-9-carboxylic acid oxazol-2-yl-amides as potent, orally available mGlu1 receptor enhancers. Bioorg Med Chem Lett. 2009 Mar 15;19(6):1666-9.
• [38] Positive allosteric modulators of the metabotropic glutamate receptor subtype 4 (mGluR4): Part I. Discovery of pyrazolo[3,4-d]pyrimidines as novel ... Bioorg Med Chem Lett. 2008 Oct 15;18(20):5626-30.
• [39] N-Acyl-N'-arylpiperazines as negative allosteric modulators of mGlu1: identification of VU0469650, a potent and selective tool compound with CNS exposure in rats. Bioorg Med Chem Lett. 2013 Jul 1;23(13):3713-8.
• [40] Neuroprotective effects of the selective type 1 metabotropic glutamate receptor antagonist YM-202074 in rat stroke models. Brain Res. 2008 Jan 29;1191:168-79.
• [41] Radioligand binding properties and pharmacological characterization of 6-amino-N-cyclohexyl-N,3-dimethylthiazolo[3,2-a]benzimidazole-2-carboxamide ... J Pharmacol Exp Ther. 2005 Oct;315(1):163-9.
• [42] Synthesis, in vitro and in vivo evaluation of [11C]MMTP: a potential PET ligand for mGluR1 receptors. Bioorg Med Chem Lett. 2010 Jun 15;20(12):3499-501.
• [43] Radiosynthesis and preliminary evaluation of 4-[18F]fluoro-N-[4-[6-(isopropylamino)pyrimidin-4-yl]-1,3-thiazol-2-yl]-N-methylbenzamide as a new positron emission tomography ligand for metabotropic glutamate receptor subtype 1. Bioorg Med Chem Lett. 2011 May 15;21(10):2998-3001.
• [44] Characterization of 1-(2-[18F] fluoro-3-pyridyl)-4-(2-isopropyl-1-oxo- isoindoline-5-yl)-5-methyl-1H-1,2,3-triazole, a PET ligand for imaging the metabotropic glutamate receptor type 1 in rat and monkey brains. J Neurochem. 2012 Apr;121(1):115-24.
• [45] Mutational analysis and molecular modeling of the allosteric binding site of a novel, selective, noncompetitive antagonist of the metabotropic glut... J Biol Chem. 2003 Mar 7;278(10):8340-7.