Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTW640A)

DTT Name	B-lymphocyte surface antigen B4 (CD19)
Synonyms	T-cell surface antigen Leu-12; Leu-12; Differentiation antigen CD19; B-lymphocyte antigen CD19
Gene Name	CD19
DTT Type	Successful target	[1]
BioChemical Class	Immunoglobulin
UniProt ID	CD19_HUMAN
TTD ID	T56365
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MPPPRLLFFLLFLTPMEVRPEEPLVVKVEEGDNAVLQCLKGTSDGPTQQLTWSRESPLKP FLKLSLGLPGLGIHMRPLAIWLFIFNVSQQMGGFYLCQPGPPSEKAWQPGWTVNVEGSGE LFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPEIWEGEPPCLPPRDSL NQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVHPKGPKSLLSLELKDDRPARDMW VMETGLLLPRATAQDAGKYYCHRGNLTMSFHLEITARPVLWHWLLRTGGWKVSAVTLAYL IFCLCSLVGILHLQRALVLRRKRKRMTDPTRRFFKVTPPPGSGPQNQYGNVLSLPTPTSG LGRAQRWAAGLGGTAPSYGNPSSDVQADGALGSRSPPGVGPEEEEGEGYEEPDSEEDSEF YENDSNLGQDQLSQDGSGYENPEDEPLGPEDEDSFSNAESYENEDEELTQPVARTMDFLS PHGSAWDPSREATSLGSQSYEDMRGILYAAPQLRSIRGQPGPNHEEDADSYENMDNPDGP DPAWGGGGRMGTWSTR
Function	Decreases the threshold for activation of downstream signaling pathways and for triggering B-cell responses to antigens. Activates signaling pathways that lead to the activation of phosphatidylinositol 3-kinase and the mobilization of intracellular Ca(2+) stores. Is not required for early steps during B cell differentiation in the blood marrow. Required for normal differentiation of B-1 cells. Required for normal B cell differentiation and proliferation in response to antigen challenges. Required for normal levels of serum immunoglobulins, and for production of high-affinity antibodies in response to antigen challenge. Functions as coreceptor for the B-cell antigen receptor complex (BCR) on B-lymphocytes.
KEGG Pathway	PI3K-Akt signaling pathway (hsa04151 ) Hematopoietic cell lineage (hsa04640 ) B cell receptor signaling pathway (hsa04662 ) Epstein-Barr virus infection (hsa05169 ) Primary immunodeficiency (hsa05340 )
Reactome Pathway	Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell (R-HSA-198933 ) Constitutive Signaling by Aberrant PI3K in Cancer (R-HSA-2219530 ) Antigen activates B Cell Receptor (BCR) leading to generation of second messengers (R-HSA-983695 ) PIP3 activates AKT signaling (R-HSA-1257604 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DTT

7 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Axicabtagene ciloleucel	DMYHN59	Diffuse large B-cell lymphoma	2A81	Approved	[2]
Blinatumomab	DMGECIJ	Acute lymphoblastic leukaemia	2A85	Approved	[1]
Inebilizumab	DMI0RHA	Neuromyelitis optica spectrum disorder	8E4A.0	Approved	[3]
Lisocabtagene maraleucel	DMP45ME	Large B-cell lymphoma	2A81	Approved	[4]
Loncastuximab tesirine	DMXSVGI	Diffuse large B-cell lymphoma	2A81	Approved	[5]
Tecartus	DMYQCWT	Mantle cell lymphoma	2A85.5	Approved	[6]
Tisagenlecleucel	DMM9BJD	Acute lymphoblastic leukaemia	2A85	Approved	[7]
------------------------------------------------------------------------------------


⏷ Show the Full List of 7 Approved Drug(s)

174 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Obexelimab	DMVIC4J	IgG4 related disease	4A43.0	Phase 3	[8]
CART-19	DMST3FM	Acute lymphoblastic leukaemia	2A85	Phase 2/3	[9]
CD19 CAR T cells	DM32148	Acute lymphoblastic leukaemia	2A85	Phase 2/3	[10]
MOR-208	DMDQOWT	Diffuse large B-cell lymphoma	2A81	Phase 2/3	[11]
CAR-T cells targeting CD19	DM28A5D	Non-hodgkin lymphoma	2B33.5	Phase 2	[12]
CART 19	DMTBFXW	Acute lymphoblastic leukaemia	2A85	Phase 2	[13]
CART-19	DMHQKN6	Acute lymphoblastic leukaemia	2A85	Phase 2	[14]
CART-19 cells	DMZUV7T	Multiple myeloma	2A83	Phase 2	[15]
CD19 CAR T cells	DMEK580	B-cell chronic lymphocytic leukaemia	2A82.00	Phase 2	[16]
CD19-targeting CAR T cells	DMQJBUK	B-cell lymphoma	2A86	Phase 2	[17]
Coltuximab ravtansine	DMSGFOY	Diffuse large B-cell lymphoma	2A81	Phase 2	[18]
CTL019	DMMPC6W	Chronic lymphocytic leukaemia	2A82.0	Phase 2	[19]
JCAR015	DM89ASO	Acute lymphoblastic leukaemia	2A85	Phase 2	[20]
KYMRIAH	DM15RZO	Acute lymphoblastic leukaemia	2A85	Phase 2	[21]
MB-CART19.1	DM0AOID	Precursor B-lymphoblastic neoplasm	2A70	Phase 2	[22]
MDX-1342	DMKMSC4	leukaemia	2A60-2B33	Phase 2	[23]
MEDI-551	DMBTVFE	Encephalopathy	8E47	Phase 2	[24]
Minjuvi	DMD725X	Lymphoma	2A80-2A86	Phase 2	[25]
SAR-3419	DMOSCBF	Non-hodgkin lymphoma	2B33.5	Phase 2	[26]
XLCART001	DMVB8EO	B-cell lymphoma	2A86	Phase 2	[27]
Xmab 5871	DMLIPY1	Autoimmune diabetes	5A10	Phase 2	[28]
4SCAR19 and 4SCAR123	DMYPQT4	B-cell lymphoma	2A86	Phase 1/2	[29]
4SCAR19 and 4SCAR20	DMFVTSG	B-cell lymphoma	2A86	Phase 1/2	[29]
4SCAR19 and 4SCAR22	DM8CMUW	B-cell lymphoma	2A86	Phase 1/2	[29]
4SCAR19 and 4SCAR30	DMUYFS1	B-cell lymphoma	2A86	Phase 1/2	[29]
4SCAR19 and 4SCAR38	DMZKFU7	B-cell lymphoma	2A86	Phase 1/2	[29]
4SCAR19 and 4SCAR70	DMKC8F9	B-cell lymphoma	2A86	Phase 1/2	[29]
4SCAR19 cells	DMIY1ZB	B-cell lymphoma	2A86	Phase 1/2	[30]
4SCAR19/22 T cells	DMI8TW3	B-cell lymphoma	2A86	Phase 1/2	[31]
ALLO-501A	DMMH65Y	Large B Cell Lymphoma		Phase 1/2	[32]
Anti-CD19 and Anti-CD20 CAR-T Cells	DMLFB25	B-cell lymphoma	2A86	Phase 1/2	[33]
Anti-CD19 CAR T cells	DMS326R	B-cell lymphoma	2A86	Phase 1/2	[34]
Anti-CD19 CAR transduced T cells	DMHSLVJ	Acute lymphocytic leukaemia	2B33.3	Phase 1/2	[35]
Anti-CD19 CAR-T	DM04HNB	Haematopoietic/lymphoid cancer	2B33.5	Phase 1/2	[36]
Anti-CD19 CAR-T cells	DMDRYZK	Acute lymphocytic leukaemia	2B33.3	Phase 1/2	[37]
Anti-CD19 CAR-T cells	DM1EH9D	leukaemia	2A60-2B33	Phase 1/2	[38]
Anti-CD19 CAR-T cells	DM92CUG	Acute lymphoblastic leukaemia	2A85	Phase 1/2	[39]
Anti-CD19 CAR-T cells	DMSFEOC	B-cell chronic lymphocytic leukaemia	2A82.00	Phase 1/2	[40]
Anti-CD19-CAR PBL	DM1WB8H	Diffuse large B-cell lymphoma	2A81	Phase 1/2	[41]
Anti-CD19-CAR vector-transduced T cells	DMQXU4C	B-cell non-hodgkin lymphoma	2B33.5	Phase 1/2	[42]
Anti-CD19-CAR-T cells	DMNTP23	leukaemia	2A60-2B33	Phase 1/2	[43]
Anti-CD19/22-CAR vector-transduced T cells	DMMUSHR	Acute lymphoblastic leukaemia	2A85	Phase 1/2	[44]
Anti-CD20 CAR-T cells	DM4WEZL	Diffuse large B-cell lymphoma	2A81	Phase 1/2	[45]
AUTO1	DMG9OAV	Acute lymphoblastic leukaemia	2A85	Phase 1/2	[46]
AUTO3	DMC5NSO	Acute lymphoblastic leukaemia	2A85	Phase 1/2	[47]
Autologous Anti-CD19CAR-4-1BB-CD3zeta-EGFRt-expressing T Lymphocytes	DM2YTGQ	Acute lymphoblastic leukaemia	2A85	Phase 1/2	[48]
Autologous CD19-targeting CAR T cells	DMLOGI4	leukaemia	2A60-2B33	Phase 1/2	[49]
CAR-T cells targeting CD19	DMIM9TZ	leukaemia	2A60-2B33	Phase 1/2	[50]
CARCIK-CD19	DMOI5PB	Acute lymphocytic leukaemia	2B33.3	Phase 1/2	[51]
CART-19 cells	DMWYT4K	Acute lymphoblastic leukaemia	2A85	Phase 1/2	[52]
CART-19/22	DMX0R1E	leukaemia	2A60-2B33	Phase 1/2	[53]
CART-19/BCMA	DMVW1GY	Multiple myeloma	2A83	Phase 1/2	[54]
CD19 and CD20 CAR-T Cells	DMRJ3ND	B-cell lymphoma	2A86	Phase 1/2	[55]
CD19 and CD22 CAR-T Cells	DM581CS	B-cell lymphoma	2A86	Phase 1/2	[56]
CD19 CAR Gene Transduced T Lymphocytes	DMQJ6YL	Non-hodgkin lymphoma	2B33.5	Phase 1/2	[57]
CD19 CAR T Cells	DMUARWH	Acute lymphoblastic leukaemia	2A85	Phase 1/2	[58]
CD19 CAR T cells	DMMHLJQ	Acute lymphoblastic leukaemia	2A85	Phase 1/2	[59]
CD19 CAR-T Cells	DMECGKO	Acute lymphoblastic leukaemia	2A85	Phase 1/2	[60]
CD19 CAR-T lymphocytes	DM8KESD	Acute lymphoblastic leukaemia	2A85	Phase 1/2	[61]
CD19 CART	DM69A1W	Acute lymphoblastic leukaemia	2A85	Phase 1/2	[62]
CD19 specific CAR T cells	DMGDK9C	Acute leukaemia	2A60	Phase 1/2	[63]
CD19 targeted chimeric antigen receptor T cells	DM8RXFB	B-cell lymphoma	2A86	Phase 1/2	[64]
CD19-CAR T cell	DMQE7TW	Acute lymphoblastic leukaemia	2A85	Phase 1/2	[65]
CD19-directed CAR-T cells	DMKQRUJ	leukaemia	2A60-2B33	Phase 1/2	[66]
CD19-TCRz-41BB and CD22-TCRz-41BB CAR-T Cells	DM4MBUI	Haematopoietic/lymphoid cancer	2B33.5	Phase 1/2	[67]
CD19.CAR T Cells	DM79GPF	Acute lymphoblastic leukaemia	2A85	Phase 1/2	[68]
CD19.CAR-T cells	DMNZ7F2	Diffuse large B-cell lymphoma	2A81	Phase 1/2	[69]
Chimeric Antigen Receptor Modified T cells Targeting CD19	DMHNFXR	leukaemia	2A60-2B33	Phase 1/2	[70]
CLIC-1901	DML8US9	Acute lymphoblastic leukaemia	2A85	Phase 1/2	[71]
Humanized CD19 CAR-T cells	DMOVF6E	Acute lymphoblastic leukaemia	2A85	Phase 1/2	[72]
IM19 CAR-T	DMKV5D6	leukaemia	2A60-2B33	Phase 1/2	[73]
JCAR014	DMTMVEW	Non-hodgkin lymphoma	2B33.5	Phase 1/2	[74]
JCAR017	DMJV2IF	Chronic lymphocytic leukaemia	2A82.0	Phase 1/2	[75]
KTE-C19 CAR	DME8JW1	Diffuse large B-cell lymphoma	2A81	Phase 1/2	[76]
PBCAR0191	DMJC2RU	Acute lymphoblastic leukaemia	2A85	Phase 1/2	[77]
PCAR-019	DM9DR13	Acute lymphocytic leukaemia	2B33.3	Phase 1/2	[78]
SCRI-huCAR19v1	DMS1NMO	leukaemia	2A60-2B33	Phase 1/2	[79]
SJCAR19	DMSOX57	Acute lymphoblastic leukaemia	2A85	Phase 1/2	[80]
TAK-007	DMJSQXT	Hematologic tumour	2B33.Y	Phase 1/2	[81]
TBI-1501	DM5NICF	Acute lymphoblastic leukaemia	2A85	Phase 1/2	[82]
TC-110	DMR65X7	Acute lymphoblastic leukaemia	2A85	Phase 1/2	[83]
TriCAR-T-CD19	DML54PD	Non-hodgkin lymphoma	2B33.5	Phase 1/2	[84]
UCART019	DMRJK26	B-cell lymphoma	2A86	Phase 1/2	[85]
19-28z T CELLS	DMJ1SQY	Non-hodgkin lymphoma	2B33.5	Phase 1	[86]
AFM11	DMIFJZD	B-cell non-hodgkin lymphoma	2B33.5	Phase 1	[87]
ALLO-501	DMGIAND	Non-hodgkin lymphoma	2B33.5	Phase 1	[88]
Allogeneic CART-19	DMCYV26	leukaemia	2A60-2B33	Phase 1	[89]
AMG 562	DMQ0N5Z	Diffuse large B-cell lymphoma	2A81	Phase 1	[90]
Anti-CD19 anti-CD20 Bispecific CAR-T	DMCABUR	leukaemia	2A60-2B33	Phase 1	[91]
Anti-CD19 CAR-T cells	DMUQ3C1	leukaemia	2A60-2B33	Phase 1	[92]
Anti-CD19 CART Cells	DMW549Y	Multiple myeloma	2A83	Phase 1	[93]
Anti-CD19 EBV CTL therapy	DMUVYC5	Acute lymphoblastic leukaemia	2A85	Phase 1	[94]
Anti-CD19-CAR	DMWKYSM	Acute lymphoblastic leukaemia	2A85	Phase 1	[95]
Anti-CD19-CAR T	DMMRANJ	leukaemia	2A60-2B33	Phase 1	[96]
Anti-CD19-CAR T cells	DMYQFCN	B-cell lymphoma	2A86	Phase 1	[97]
Anti-CD19/BCMA CAR-T cells	DMF93T2	Multiple myeloma	2A83	Phase 1	[98]
AntiCD19 CART	DMH789J	Non-hodgkin lymphoma	2B33.5	Phase 1	[99]
ARI-0001 cells	DMPLHBI	leukaemia	2A60-2B33	Phase 1	[100]
BCMA CART and huCART19	DM2V4EO	Multiple myeloma	2A83	Phase 1	[101]
BCMA-CD19 cCAR	DMZ13WQ	Multiple myeloma	2A83	Phase 1	[102]
C-CAR011	DM86CZJ	Non-hodgkin lymphoma	2B33.5	Phase 1	[103]
CAR-20/19-T Cells	DM4CXE2	B-cell non-hodgkin lymphoma	2B33.5	Phase 1	[104]
CAR-T cells targeting CD19	DMJK1R0	Lymphoma	2A80-2A86	Phase 1	[105]
CAR-T Cells targeting CD19	DM3AHNX	Acute lymphoblastic leukaemia	2A85	Phase 1	[106]
CAR19 T cells carrying cytoplasmic activated PD-1	DMXD4TC	Non-hodgkin lymphoma	2B33.5	Phase 1	[107]
CART-19	DM1R8P4	B-cell lymphoma	2A86	Phase 1	[108]
CART-19	DM8R2ZX	Acute lymphoblastic leukaemia	2A85	Phase 1	[109]
CART-19 autologous T-cells	DMY218P	Lymphoma	2A80-2A86	Phase 1	[110]
CART-19 cells	DMHWVY1	Acute lymphoblastic leukaemia	2A85	Phase 1	[111]
CART-19 cells	DMKW27X	Acute lymphoblastic leukaemia	2A85	Phase 1	[112]
CART-19 T cells	DMTCB8I	Multiple myeloma	2A83	Phase 1	[113]
CART-meso-19 T cells	DMZ4I03	Pancreatic cancer	2C10	Phase 1	[114]
CART19 cell	DMM95XS	B-cell prolymphocytic leukaemia	2A82.1	Phase 1	[115]
CART22-65s cells and huCART19 Cells	DMOJ1AH	Acute lymphoblastic leukaemia	2A85	Phase 1	[116]
CARTmeso/19	DMV84ZR	Pancreatic cancer	2C10	Phase 1	[117]
CarVAC	DM39LPN	B-cell lymphoma	2A86	Phase 1	[118]
CC-97540	DMLONJG	Non-hodgkin lymphoma	2B33.5	Phase 1	[119]
CD19 CAR T	DM4PWNU	Acute lymphoblastic leukaemia	2A85	Phase 1	[120]
CD19 CAR T Cells	DMCUBFR	Acute lymphocytic leukaemia	2B33.3	Phase 1	[121]
CD19 CAR T cells	DMB8RI6	Acute lymphoblastic leukaemia	2A85	Phase 1	[122]
CD19 CAR T-cells	DMJCT6Q	Acute lymphoblastic leukaemia	2A85	Phase 1	[123]
CD19 CAR-T cells	DM6GNDP	Acute lymphoblastic leukaemia	2A85	Phase 1	[124]
CD19 CAR-T cells	DMNDACU	Acute lymphoblastic leukaemia	2A85	Phase 1	[125]
CD19 Redirected Autologous T Cells	DM49RAT	Systemic lupus erythematosus	4A40.0	Phase 1	[126]
CD19+ CAR T Cells	DMGUQ8V	leukaemia	2A60-2B33	Phase 1	[127]
CD19-CAR and CD28-CAR T Cells	DMUR1MN	Acute lymphoblastic leukaemia	2A85	Phase 1	[128]
CD19-CAR-T Cells	DMJIW5Z	Acute lymphoblastic leukaemia	2A85	Phase 1	[129]
CD19-CAR-T2 Cells	DML07UZ	Acute lymphoblastic leukaemia	2A85	Phase 1	[130]
CD19-directed CAR-T cells	DM2OEQ9	Non-hodgkin lymphoma	2B33.5	Phase 1	[131]
CD19-directed CAR-T cells	DMETGAQ	leukaemia	2A60-2B33	Phase 1	[132]
CD19-targeted CART cells	DMCZ3A2	leukaemia	2A60-2B33	Phase 1	[133]
CD19-TriCAR-T	DMOHACZ	Non-hodgkin lymphoma	2B33.5	Phase 1	[134]
CD19.CAR-aNKT cells	DMMO2EJ	B-cell small lymphocytic lymphoma	2A82.0	Phase 1	[135]
CD19/CD22 CAR T cells	DMVONF0	Acute lymphoblastic leukaemia	2A85	Phase 1	[136]
CD19/CD22 CAR T-Cells	DMKA2FL	Acute lymphocytic leukaemia	2B33.3	Phase 1	[137]
CD19/CD22 Chimeric Antigen Receptor T Cells	DMPADR1	Acute lymphoblastic leukaemia	2A85	Phase 1	[138]
CD19CAT-41BBZ CAR T-cells	DM3LRAF	Acute lymphoblastic leukaemia	2A85	Phase 1	[139]
CD19t-haNK	DMT7YOU	Diffuse large B-cell lymphoma	2A81	Phase 1	[140]
CD20-CD19 cCAR	DMUYTW3	B-cell lymphoma	2A86	Phase 1	[141]
Combotox	DMA7PWX	leukaemia	2A60-2B33	Phase 1	[142]
CTX-101	DMHK9WR	B-cell lymphoma	2A86	Phase 1	[143]
Donor-derived CD19/22 bispecific CAR-T cells	DMZS350	leukaemia	2A60-2B33	Phase 1	[132]
Duvortuxizumab	DM3P0H1	B-cell lymphoma	2A86	Phase 1	[18]
EGFRt/19-28z/4-1BBL CAR T cells	DMZN35T	Chronic lymphocytic leukaemia	2A82.0	Phase 1	[144]
ET019002	DMRW1Q3	B-cell lymphoma	2A86	Phase 1	[145]
ET019003	DMUOM5P	B-cell lymphoma	2A86	Phase 1	[146]
FT-819	DMGJNTQ	Chronic lymphocytic leukaemia	2A82.0	Phase 1	[147]
HuCART19	DMNAR29	leukaemia	2A60-2B33	Phase 1	[148]
Human CD19 targeted T Cells	DM0W275	Diffuse large B-cell lymphoma	2A81	Phase 1	[149]
IC9-CAR19 cells	DMP1ZF8	Acute lymphoblastic leukaemia	2A85	Phase 1	[150]
IC9-CAR19 T cells	DMNCBIU	B-cell lymphoma	2A86	Phase 1	[151]
ICAR19 CAR-T cells	DMHG4Q9	B-cell lymphoma	2A86	Phase 1	[152]
IM19	DM43X0Q	Haematological malignancy	2B33.Y	Phase 1	[153]
JWCAR029	DMHMDC0	Non-hodgkin lymphoma	2B33.5	Phase 1	[154]
KITE-363	DMIZPF4	B-cell lymphoma	2A86	Phase 1	[155]
KUR-502	DMS9LVC	B-cell lymphoma	2A86	Phase 1	[156]
MEDl-551	DM1ALHT	Scleroderma	4A42	Phase 1	[157]
NKX019	DMOQDN0	Chronic lymphocytic leukaemia	2A82.0	Phase 1	[158]
Patient-derived CD19- and CD22 specific CAR	DMZSD3T	leukaemia	2A60-2B33	Phase 1	[159]
PZ01 CAR-T cells	DMRGWDB	Acute lymphoblastic leukaemia	2A85	Phase 1	[160]
RG6333	DM1BRF2	Non-hodgkin lymphoma	2B33.5	Phase 1	[161]
RO7443904	DMSWZNU	Non-hodgkin lymphoma	2B33.5	Phase 1	[162]
Sleeping Beauty CAR-TCR	DMVUL1H	leukaemia	2A60-2B33	Phase 1	[163]
TAK-940	DM1SNUB	Haematological malignancy	2B33.Y	Phase 1	[164]
TG-1801	DM3K4FY	B-cell lymphoma	2A86	Phase 1	[165]
TNB-486	DMSRICG	B-cell lymphoma	2A86	Phase 1	[166]
YTB323	DM5BMIO	Chronic lymphocytic leukaemia	2A82.0	Phase 1	[167]
Anti-CD19 Chimeric Antigen Receptor T Cells	DM6NVPT	leukaemia	2A60-2B33	Clinical trial	[168]
Anti-CD19/20-CAR vector-transduced T cells	DM3M9OY	Acute lymphoblastic leukaemia	2A85	Clinical trial	[169]
CAR-CD19 T cell	DMXU2D1	B-cell lymphoma	2A86	Clinical trial	[170]
CD19-CAR T Cells	DM2V6R7	Acute lymphoblastic leukaemia	2A85	Clinical trial	[171]
CD19-targeted CAR-T cells	DMLPAFG	leukaemia	2A60-2B33	Clinical trial	[172]
CD19-UCART	DM8VTF2	Acute lymphoblastic leukaemia	2A85	Clinical trial	[173]
CD19CART	DMF936G	B-cell lymphoma	2A86	Clinical trial	[174]
------------------------------------------------------------------------------------


⏷ Show the Full List of 174 Clinical Trial Drug(s)

4 Preclinical Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
CART19 cells	DMFRA38	Hodgkin lymphoma	2B30	Phase 0	[175]
ATA2431	DM34FEA	B-cell lymphoma	2A86	Preclinical	[176]
ATA3219	DMJTYH3	B-cell lymphoma	2A86	Preclinical	[176]
SGN-19A	DMH1WNI	Haematological malignancy	2B33.Y	Preclinical	[177]
------------------------------------------------------------------------------------

1 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Anti-CD22/CD19 mab-toxin conjugate	DM8QIB2	Acute lymphoblastic leukaemia	2A85	Investigative	[178]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTT

Molecular Expression Atlas (MEA)

MEA Detail

Jump to Detail Molecular Expression Atlas of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Acute myelocytic leukaemia	2C82	Bone marrow	2.33E-24	-1.06	-1.33
Multiple myeloma	2C82	Bone marrow	2.33E-07	-1.9	-6.64
------------------------------------------------------------------------------------

References

1	2014 FDA drug approvals. Nat Rev Drug Discov. 2015 Feb;14(2):77-81.
2	Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services
3	Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services. 2020
4	Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services.
5	Final results of a phase 1 study of loncastuximab tesirine in relapsed/refractory B-cell non-Hodgkin lymphoma. Blood. 2021 May 13;137(19):2634-2645.
6	Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services.
7	2017 FDA drug approvals.Nat Rev Drug Discov. 2018 Feb;17(2):81-85.
8	Emerging B-Cell Therapies in Systemic Lupus Erythematosus. Ther Clin Risk Manag. 2021 Jan 14;17:39-54.
9	ClinicalTrials.gov (NCT03027739) CART-19 Cells For MRD Positive CD19+ ALL
10	ClinicalTrials.gov (NCT03391726) CART-19 Cells for R/R B-cell Lymphoma
11	A phase 1 trial of the Fc-engineered CD19 antibody XmAb5574 (MOR00208) demonstrates safety and preliminary efficacy in relapsed CLL. Blood. 2014 Dec 4;124(24):3553-60.
12	ClinicalTrials.gov (NCT03196830) CAR-T for R/R B-NHL
13	ClinicalTrials.gov (NCT02935543) CART19 in Adult Patients With Minimal Residual Disease During Upfront Treatment for ALL
14	ClinicalTrials.gov (NCT01029366) CART19 to Treat B-Cell Leukemia or Lymphoma That Are Resistant or Refractory to Chemotherapy
15	ClinicalTrials.gov (NCT01551043) Allo CART-19 Protocol
16	ClinicalTrials.gov (NCT02846584) a Clinical Research of Sequential CAR-T Bridging HSCT in the Treatment of Relapse/Refractory B-cell Malignancies
17	ClinicalTrials.gov (NCT02547948) CD19-targeting CAR T Cells for B Cell Lymphoma
18	Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
19	ClinicalTrials.gov (NCT02445248) Study of Efficacy and Safety of CTL019 in Adult DLBCL Patients. U.S. National Institutes of Health.
20	ClinicalTrials.gov (NCT02535364) Study Evaluating the Efficacy and Safety of JCAR015 in Adult B-cell Acute Lymphoblastic Leukemia (B-ALL).
21	ClinicalTrials.gov (NCT03642626) MT2017-45 :CAR-T Cell Therapy for Heme Malignancies
22	ClinicalTrials.gov (NCT03321123) MB-CART19.1 in Patients With R/R ALL
23	A nonfucosylated human antibody to CD19 with potent B-cell depletive activity for therapy of B-cell malignancies. Cancer Immunol Immunother. 2010 Feb;59(2):257-65.
24	Clinical pipeline report, company report or official report of MedImmune (2011).
25	Tafasitamab: First Approval. Drugs. 2020 Nov;80(16):1731-1737.
26	A dose-escalation study of SAR3419, an anti-CD19 antibody maytansinoid conjugate, administered by intravenous infusion once weekly in patients with relapsed/refractory B-cell non-Hodgkin lymphoma. Clin Cancer Res. 2014 Jan 1;20(1):213-20.
27	ClinicalTrials.gov (NCT03598179) XLCART001 Treatment in Relapsed/Refractory/High-risk B-cell Malignancy Subjects
28	Suppression of rheumatoid arthritis B cells by XmAb5871, an anti-CD19 antibody that coengages B cell antigen receptor complex and Fc receptor IIb inhibitory receptor.Arthritis Rheumatol.2014 May;66(5):1153-64.
29	ClinicalTrials.gov (NCT03125577) Combination CAR-T Cell Therapy Targeting Hematological Malignancies
30	ClinicalTrials.gov (NCT03050190) A Phase I/II Multiple Center Trial of 4SCAR19 Cells in the Treatment of Relapsed and Refractory B Cell Malignancies
31	ClinicalTrials.gov (NCT03098355) Interleukin-2 Following 4SCAR19/22 T Cells Targeting Refractory and/or Recurrent B Cell Malignancies
32	ClinicalTrials.gov (NCT04416984) A Single-Arm, Open-Label, Phase 1/2 Study Evaluating the Safety, Efficacy, and Cellular Kinetics/Pharmacodynamics of ALLO-501A, an Anti-CD19 Allogeneic CAR T Cell Therapy, and ALLO-647, an Anti-CD52 Monoclonal Antibody, in Subjects With Relapsed/Refractory Large B-Cell Lymphoma (LBCL). U.S.National Institutes of Health.
33	ClinicalTrials.gov (NCT03207178) Sequential Infusion of Anti-CD19 and Anti-CD20 CAR-T Cells Against Relapsed and Refractory B-cell Lymphoma
34	ClinicalTrials.gov (NCT02277522) CD19 Redirected Autologous T Cells for Hodgkin Lymphoma
35	ClinicalTrials.gov (NCT03191773) A Study of Anti-CD19 CAR-T Cell Immunotherapy for Refractory /Relapsed B Cell Malignancies
36	ClinicalTrials.gov (NCT03110640) Anti-CD19 CAR T Infusion Combined With Allogeneic Stem Cell Transplantation for B-cell Leukemia/Lymphoma
37	ClinicalTrials.gov (NCT02851589) Study Evaluating the Efficacy and Safety of PCAR-019 in CD19 Positive Relapsed or Refractory Leukemia and Lymphoma
38	ClinicalTrials.gov (NCT03638206) Autologous CAR-T/TCR-T Cell Immunotherapy for Malignancies
39	ClinicalTrials.gov (NCT03366324) Anti-CD19 CAR-T Therapy Combine With HSCT to Treat MRD+ B-cell Malignancies
40	ClinicalTrials.gov (NCT02782351) Humanized CAR-T Therapy for Treatment of B Cell Malignancy
41	ClinicalTrials.gov (NCT00924326) CAR T Cell Receptor Immunotherapy for Patients With B-cell Lymphoma
42	ClinicalTrials.gov (NCT02081937) CART-19 Immunotherapy in Mantle Cell Lymphoma
43	ClinicalTrials.gov (NCT02672501) A Study to Assess CD19-targeted Immunotherapy T Cells in Patients With Relapsed or Refractory CD19+ B Cell Leukemia
44	ClinicalTrials.gov (NCT03185494) Treatment of Relapsed and/or Chemotherapy Refractory B-cell Malignancy by Tandem CAR T Cells Targeting CD19 and CD22
45	ClinicalTrials.gov (NCT02737085) the Sequential Therapy of CD19-targeted and CD20-targeted CAR-T Cell Therapy for Diffuse Large B Cell Lymphoma(DLBCL)
46	Clinical pipeline report, company report or official report of Autolus Therapeutics.
47	ClinicalTrials.gov (NCT03289455) CD19 /22 CAR T Cells (AUTO3) for the Treatment of B Cell ALL
48	ClinicalTrials.gov (NCT01865617) Laboratory Treated T Cells in Treating Patients With Relapsed or Refractory Chronic Lymphocytic Leukemia, Non-Hodgkin Lymphoma, or Acute Lymphoblastic Leukemia
49	ClinicalTrials.gov (NCT02963038) CAR T Cells for Refractory B Cell Malignancy
50	ClinicalTrials.gov (NCT03312205) CAR-T Cells for Relapsed or Refractory Haematopoietic and Lymphoid Malignancies
51	ClinicalTrials.gov (NCT03389035) Transposon-manipulated Allogeneic CARCIK-CD19 Cells in Pediatric and Adult Patients With r/r ALL Post HSCT
52	ClinicalTrials.gov (NCT03544021) CART-19 FOR Relapsed/Refractory Acute Lymphoblastic Leukemia ALL
53	ClinicalTrials.gov (NCT03614858) CD19/CD22-targeted Chimeric Antigen Receptor Engineered T Cell (CART) in B-Cell Acute Lymphoblastic Leukemia.
54	ClinicalTrials.gov (NCT03455972) Study of T Cells Targeting CD19/BCMA (CART-19/BCMA) for High Risk Multiple Myeloma Followed With Auto-HSCT
55	ClinicalTrials.gov (NCT03398967) A Feasibility and Safety Study of Universal Dual Specificity CD19 and CD20 or CD22 CAR-T Cell Immunotherapy for Relapsed or Refractory Leukemia and Lymphoma
56	ClinicalTrials.gov (NCT03468153) Dual Specificity CD19 and CD22 CAR-T Cell Immunotherapy for CD19+CD22+ Relapsed and Refractory Lymphoma
57	ClinicalTrials.gov (NCT02134262) Gene Therapy for B-Cell Non-Hodgkin Lymphoma Using CD19 CAR Gene Transduced T Lymphocytes
58	ClinicalTrials.gov (NCT01475058) CD19 CAR T Cells for B Cell Malignancies After Allogeneic Transplant
59	ClinicalTrials.gov (NCT02772198) T-cells Expressing Anti-CD19 CAR in Pediatric and Young Adults With B-cell Malignancies
60	ClinicalTrials.gov (NCT03263208) CD19 CAR-T Cells for Patients With Relapse and Refractory CD19+ B-ALL.
61	ClinicalTrials.gov (NCT03467256) CD19 T-CAR for Treatment of Children and Young Adults With r/r B-ALL
62	ClinicalTrials.gov (NCT03146533) CD19 CART Cells for Patients With Relapse and Refractory CD19+ B-cell Lymphoma.
63	ClinicalTrials.gov (NCT02028455) A Pediatric and Young Adult Trial of Genetically Modified T Cells Directed Against CD19 for Relapsed/Refractory CD19+ Leukemia
64	ClinicalTrials.gov (NCT03118180) CD19 Targeted Chimeric Antigen Receptor T Cells for B Cell Lymphoma
65	ClinicalTrials.gov (NCT03373071) Anti-CD19 CAR T Cells in Pediatric Patients Affected by Relapsed/Refractory CD19+ ALL and NHL
66	ClinicalTrials.gov (NCT02537977) CD19-directed CAR T Cells Therapy in Relapsed/Refractory B Cell Malignancy
67	ClinicalTrials.gov (NCT02903810) Combination Transfer of CD19-TCRz-41BB and CD22-TCRz-41BB CAR-T Cells for B-cell Hematologic Malignancy
68	ClinicalTrials.gov (NCT03676504) Treatment of Patients With Relapsed or Refractory CD19+ Lymphoid Disease With T Cells Expressing a Third-generation CAR
69	ClinicalTrials.gov (NCT02652910) Memory-enriched CAR-T Cells Immunotherapy for B Cell Lymphoma
70	ClinicalTrials.gov (NCT02349698) A Clinical Research of CAR T Cells Targeting CD19 Positive Malignant B-cell Derived Leukemia and Lymphoma
71	ClinicalTrials.gov (NCT03765177) CLIC-1901 for the Treatment of Patients With Relapsed/Refractory CD19 Positive Hematologic Malignancies
72	ClinicalTrials.gov (NCT03275493) Humanized CD19 CAR-T Cells With CRS Suppression Technology for r/r CD19+ Acute Lymphoblastic Leukemia
73	ClinicalTrials.gov (NCT03142646) Safety and Efficacy Evaluation of IM19 CAR-T Cells
74	ClinicalTrials.gov (NCT02706405) JCAR014 and Durvalumab in Treating Patients With Relapsed or Refractory B-cell Non-Hodgkin Lymphoma
75	ClinicalTrials.gov (NCT03436771) Long-term Follow-up Study for Patients Previously Treated With a Juno CAR T-Cell Product
76	Clinical pipeline report, company report or official report of Kite Pharma.
77	ClinicalTrials.gov (NCT03666000) Dose-escalation Study of Safety of PBCAR0191 in Patients With r/r NHL and r/r B-cell ALL
78	ClinicalTrials.gov (NCT02819583) CAR-T Cell Immunotherapy in CD19 Positive Relapsed or Refractory Leukemia and Lymphoma
79	ClinicalTrials.gov (NCT03684889) CD19-specific CAR T Cells With a Fully Human Binding Domain for CD19+ Leukemia or Lymphoma
80	ClinicalTrials.gov (NCT03573700) Evaluation of CD19-Specific CAR Engineered Autologous T-Cells for Treatment of Relapsed/Refractory CD19+ Acute Lymphoblastic Leukemia
81	Clinical pipeline report, company report or official report of Takeda.
82	ClinicalTrials.gov (NCT03155191) Study of TBI-1501 for Relapsed or Refractory Acute Lymphoblastic Leukemia
83	Clinical pipeline report, company report or official report of TCR2 Therapeutics.
84	ClinicalTrials.gov (NCT03497533) Treatment of Refractory/Relapsed Non-Hodgkin Lymphoma With TriCAR-T_CD19
85	ClinicalTrials.gov (NCT03166878) A Study Evaluating UCART019 in Patients With Relapsed or Refractory CD19+ Leukemia and Lymphoma
86	ClinicalTrials.gov (NCT01840566) High Dose Therapy and Autologous Stem Cell Transplantation Followed by Infusion of Chimeric Antigen Receptor (CAR) Modified T-Cells Directed Against CD19+ B-Cells for Relapsed and Refractory Aggressive B Cell Non-Hodgkin Lymphoma
87	A tetravalent bispecific TandAb (CD19/CD3), AFM11, efficiently recruits T cells for the potent lysis of CD19(+) tumor cells. MAbs. 2015;7(3):584-604.
88	Clinical pipeline report, company report or official report of Allogene Therapeutics.
89	ClinicalTrials.gov (NCT02799550) Allogeneic CART-19 for Elderly Relapsed/Refractory CD19+ ALL
90	Clinical pipeline report, company report or official report of Amgen.
91	ClinicalTrials.gov (NCT03271515) Immunotherapy With Bispecific CAR-T Cells for B-Cell Lymphoma, ALL and CLL
92	ClinicalTrials.gov (NCT03121625) CAR-T Therapy in Relapsed or Refractory Haematopoietic and Lymphoid Malignancies
93	ClinicalTrials.gov (NCT03767725) Anti-BCMA or/and Anti-CD19 CART Cells Treatment of Relapsed Multiple Myeloma
94	Cytotoxic T cells transduced with chimeric anti-CD19 receptors prevent engraftment of primary lymphoblastic leukemia in vivo. Leukemia. 2010 May;24(5):1080-4.
95	ClinicalTrials.gov (NCT01593696) Anti-CD19 White Blood Cells for Children and Young Adults With B Cell Leukemia or Lymphoma
96	ClinicalTrials.gov (NCT02546739) Immunotherapy With CD19 CAR T-cells for B-Cell Lymphoma, ALL and CLL
97	ClinicalTrials.gov (NCT02659943) T Cells Expressing a Fully-human AntiCD19 Chimeric Antigen Receptor for Treating B-cell Malignancies
98	ClinicalTrials.gov (NCT03706547) Anti-CD19/BCMA Bispecific CAR-T Cell Therapy for R/R MM
99	ClinicalTrials.gov (NCT03434769) AntiCD19 Chimeric Antigen Receptor T Cells for Relapsed or Refractory Non Hodgkin Lymphoma
100	ClinicalTrials.gov (NCT03144583) Pilot Study on the Infusion of ARI-0001 Cells in Patients With CD19+ Leukemia or Lymphoma Refractory to Therapy
101	ClinicalTrials.gov (NCT03549442) Up-front CART-BCMA With or Without huCART19 in High-risk Multiple Myeloma
102	Clinical pipeline report, company report or official report of iCell Gene Therapeutics.
103	ClinicalTrials.gov (NCT03299738) A Study Evaluating Safety and Efficacy of C-CAR011 in Subjects With B-NHL
104	ClinicalTrials.gov (NCT03375619) Long-term Follow-up Study of Patients Receiving CAR-20/19-T Cells
105	ClinicalTrials.gov (NCT03086954) Study Evaluating the Efficacy and Safety With CAR-T Immunotherapy for CD19 Positive Lymphoma
106	ClinicalTrials.gov (NCT03186118) Pilot Study of T-APCs Following CAR T Cell Immunotherapy for CD19+ Leukemia
107	ClinicalTrials.gov (NCT03540303) Cytoplasmic Activated PD-1 CAR T Cells in Refractory/Relapsed B Cell Lymphoma
108	ClinicalTrials.gov (NCT03101709) The Safety and Efficacy of CART-19 Cells in Relapse and Refractory Patients With CD19+ B-cell Lymphoma
109	ClinicalTrials.gov (NCT02810223) Efficacy of CART-19 Cell Therapy in B Cell Acute Lymphoblastic Leukemia
110	ClinicalTrials.gov (NCT02476734) FDG-PET/CT Imaging as Early Predictor of DP
111	ClinicalTrials.gov (NCT03291444) CAR-T Cells Combined With Peptide Specific Dendritic Cell in Relapsed/Refractory Leukemia/MDS
112	ClinicalTrials.gov (NCT02924753) The Safety and Efficacy of CART-19 Cells in B-cell Acute Lymphoblastic Leukemia (B-ALL).
113	ClinicalTrials.gov (NCT02135406) CART-19 for Multiple Myeloma
114	ClinicalTrials.gov (NCT02465983) Pilot Study of Autologous T-cells in Patients With Metastatic Pancreatic Cancer
115	ClinicalTrials.gov (NCT03685786) CART19 Cells Treatment of MRD of B Cell Malignancies and Then Auto-HSCT
116	ClinicalTrials.gov (NCT03620058) CART22 Alone or in Combination With huCART19 for ALL
117	ClinicalTrials.gov (NCT03497819) Autologous CARTmeso/19 Against Pancreatic Cancer
118	ClinicalTrials.gov (NCT04156243) CD19 CARvac T Cells for Patients With Relapsed / Refractory B Cell Malignancies. U.S. National Institutes of Health.
119	A Study of CC-97540, CD19-targeted NEX-T Chimeric Antigen Receptor (CAR) T Cells, in Subjects With Relapsed or Refractory B-cell Non-Hodgkin Lymphoma
120	ClinicalTrials.gov (NCT03559439) CD19-targeting CAR T Cells in Relapsed or Refractory CD19 Positive B-cell Malignancies
121	ClinicalTrials.gov (NCT01853631) Activated T-Cells Expressing 2nd or 3rd Generation CD19-Specific CAR, Advanced B-Cell NHL, ALL, and CLL (SAGAN)
122	ClinicalTrials.gov (NCT02975687) CD19 CAR T Cells in Patients With Resistant or Refractory CD19+ Acute Lymphoblastic Leukemia
123	ClinicalTrials.gov (NCT03298828) CD19 CAR and PD-1 Knockout Engineered T Cells for CD19 Positive Malignant B-cell Derived Leukemia and Lymphoma
124	ClinicalTrials.gov (NCT03671460) CD19 CAR-T Cells for Patients With Relapse and Refractory CD19+ B-ALL.
125	ClinicalTrials.gov (NCT03064269) CAR-T Therapy for Central Nervous System B-cell Acute Lymphocytic Leukemia
126	ClinicalTrials.gov (NCT03030976) A Study of CD19 Redirected Autologous T Cells for CD19 Positive Systemic Lupus Erythematosus (SLE)
127	ClinicalTrials.gov (NCT02529813) CD19+ CAR T Cells for Lymphoid Malignancies
128	ClinicalTrials.gov (NCT02146924) Cellular Immunotherapy in Treating Patients With High-Risk Acute Lymphoblastic Leukemia
129	ClinicalTrials.gov (NCT03574168) CD19-CAR-T Cells in Patients With R/R B-ALL
130	ClinicalTrials.gov (NCT02822326) Phase I Study of CD19-CAR-T2 Cells for Patients With Chemotherapy Resistant or Refractory CD19+ Acute Leukemia
131	ClinicalTrials.gov (NCT03483688) A Phaseb Study Evaluating Safety and Efficacy of C-CAR011 Treatment in B- NHL Subjects
132	ClinicalTrials.gov (NCT03463928) A Feasibility and Safety Study of Concomitant Therapy With Allo-CAR-T Cells and Allo-HSCT in Patients With Relapse or Refractory Leukemia
133	ClinicalTrials.gov (NCT03599375) Immunotherapy With CD19 CART-cells for B Cell Acute Lymphoblastic Leukemia
134	ClinicalTrials.gov (NCT03720496) Treatment of Refractory/Relapsed Non-Hodgkin Lymphoma With CD19-TriCAR-T Cell Therapy
135	ClinicalTrials.gov (NCT03774654) CD19.CAR Allogeneic NKT for Patients With Relapsed or Refractory B-Cell Malignancies (ANCHOR)
136	ClinicalTrials.gov (NCT03241940) CD19/CD22 Chimeric Antigen Receptor T Cells and Chemotherapy in Treating Children or Young Adults With Recurrent or Refractory CD19 Positive B Acute Lymphoblastic Leukemia
137	ClinicalTrials.gov (NCT03448393) CD19/CD22 Chimeric Antigen Receptor (CAR) T Cells in Children and Young Adults With Recurrent or Refractory CD19/CD22-expressing B Cell Malignancies
138	ClinicalTrials.gov (NCT03233854) CD19/CD22 Chimeric Antigen Receptor T Cells and Chemotherapy in Treating Patients With Recurrent or Refractory CD19 Positive Diffuse Large B-Cell Lymphoma or B Acute Lymphoblastic Leukemia
139	ClinicalTrials.gov (NCT02935257) Immunotherapy for High Risk/Relapsed CD19+ Acute Lymphoblastic Leukaemia Using CAR T-cells to Target CD19
140	ClinicalTrials.gov (NCT04052061) QUILT 3.061: CD19 t-haNK in Subjects With Diffuse Large B-Cell Lymphoma. U.S. National Institutes of Health.
141	Clinical pipeline report, company report or official report of iCell Gene Therapeutics.
142	A phase I study of a combination of anti-CD19 and anti-CD22 immunotoxins (Combotox) in adult patients with refractory B-lineage acute lymphoblastic leukaemia.Br J Haematol.2011 Aug;154(4):471-6.
143	Off-the-shelf' allogeneic CAR T cells: development and challenges. Nat Rev Drug Discov. 2020 Mar;19(3):185-199.
144	ClinicalTrials.gov (NCT03085173) A Trial of "Armored" CAR T Cells Targeting CD19 For Patients With Relapsed CD19+ Hematologic Malignancies
145	ClinicalTrials.gov (NCT03642496) The Clinical Study of Structurally Optimized ET019002-T Cell Therapy for Refractory/Relapsed B-Cell Malignancies. U.S.National Institutes of Health.
146	Novel CD19-specific gamma-delta TCR-T cells in relapsed or refractory diffuse large B-cell lymphoma. J Hematol Oncol. 2023 Jan 21;16(1):5.
147	Clinical pipeline report, company report or official report of Fate Therapeutics.
148	ClinicalTrials.gov (NCT02374333) Pilot Study of Redirected Autologous T Cells Engineered to Contain Humanized Anti-CD19 in Patients With Relapsed or Refractory CD19+ Leukemia and Lymphoma Previously Treated With Cell Therapy
149	ClinicalTrials.gov (NCT03720457) Human CD19 Targeted T Cells Injection(CD19 CAR-T) Therapy for Relapsed and Refractory CD19-positive Lymphoma.
150	ClinicalTrials.gov (NCT03016377) Administration of Autologous CAR-T CD19 Antigen With Inducible Safety Switch in Patients With Relapsed/Refractory Acute Lymphoblastic Leukemia
151	ClinicalTrials.gov (NCT03696784) Anti-CD19 CAR-T Cells With Inducible Caspase 9 Safety Switch for B-cell Lymphoma
152	ClinicalTrials.gov (NCT03383952) A Clinical Study of CD19 Targeted CAR-T for Patients With CD19+ Lymphoma and Leukemia
153	ClinicalTrials.gov (NCT03528421) Assessment of Safety and Efficacy of IM19 for Relapsed or Refractory NHL Patients
154	ClinicalTrials.gov (NCT03344367) Study Evaluating the Safety and Efficacy of JWCAR029 in Adult Subjects With Relapsed and Refractory B-cell Non-Hodgkin Lymphoma
155	Clinical pipeline report, company report or official report of Gilead
156	Clinical pipeline report, company report or official report of Kuur Therapeutics.
157	CD19 as an attractive target for antibody-based therapy. MAbs. 2012 Sep-Oct;4(5):571-7.
158	Clinical pipeline report, company report or official report of Nkarta
159	ClinicalTrials.gov (NCT03330691) A Feasibility and Safety Study of Dual Specificity CD19 and CD22 CAR-T Cell Immunotherapy for CD19+CD22+ Leukemia and Lymphoma
160	ClinicalTrials.gov (NCT03281551) Efficacy and Safety of PZ01 Treatment in Patients With r/r CD19+ B-cell Acute Lymphoblastic Leukemia/B Cell Lymphoma
161	Clinical pipeline report, company report or official report of Roche
162	Clinical pipeline report, company report or official report of Genentch
163	Clinical pipeline report, company report or official report of Ziopharm Oncology.
164	Clinical pipeline report, company report or official report of TAKEDA
165	Clinical pipeline report, company report or official report of TG Theraputics.
166	Clinical pipeline report, company report or official report of Teneobio.
167	Clinical pipeline report, company report or official report of Novartis.
168	ClinicalTrials.gov (NCT03624686) Production of Clinical-grade Anti-CD19 Chimeric Antigen Receptor T Cells for Refractory B-cell Malignancies
169	ClinicalTrials.gov (NCT03097770) Treatment of Relapsed and/or Chemotherapy Refractory B-cell Malignancy by Tandem CAR T Cells Targeting CD19 and CD20
170	ClinicalTrials.gov (NCT03302403) Clinical Study of Redirected Autologous T Cells With a Chimeric Antigen Receptor in Patients With Malignant Tumors
171	ClinicalTrials.gov (NCT03423706) Clinical Studies of New Model Haploidentical Hematopoietic Stem Cell Transplantation
172	ClinicalTrials.gov (NCT02728882) Study Evaluating the Efficacy and Safety With CAR-T for Recurrent or Refractory Diffuse Large B Cell Lymphoma
173	ClinicalTrials.gov (NCT03229876) Safety and Efficacy Evaluation of CD19-UCART
174	ClinicalTrials.gov (NCT02813837) Chimeric Antigen Receptor T Cells (CART) Therapy in Refractory/Relapsed B Cell Hematologic Malignancies
175	ClinicalTrials.gov (NCT02624258) Pilot Study of Non-Viral, RNA-Redirected Autologous T Cells in Patients With Refractory or Relapsed Hodgkin Lymphoma
176	Clinical pipeline report, company report or official report of Atara Biotherapeutics.
177	2011 Pipeline of Seattle Genetics.
178	Immunotoxins against CD19 and CD22 are effective in killing precursor-B acute lymphoblastic leukemia cells in vitro. Leukemia. 2000 May;14(5):853-8.