Details of the Drug

General Information of Drug (ID: DMGECIJ)

• Drug Name: Blinatumomab
• Synonyms: AMG 103; Blincyto

Indication

Disease Entry	ICD 11	Status	REF
Acute lymphoblastic leukaemia	2A85	Approved	[1]
B-cell acute lymphoblastic leukaemia	2B33.3	Approved	[2]
Diffuse large B-cell lymphoma	2A81	Phase 2/3	[3]

• Drug Type: Monoclonal antibody
• Sequence:
  DIQLTQSPASLAVSLGQRATISCKASQSVDYDGDSYLNWYQQIPGQPPKLLIYDASNLVS
  GIPPRFSGSGSGTDFTLNIHPVEKVDAATYHCQQSTEDPWTFGGGTKLEIKGGGGSGGGG
  SGGGGSQVQLQQSGAELVRPGSSVKISCKASGYAFSSYWMNWVKQRPGQGLEWIGQIWPG
  DGDTNYNGKFKGKATLTADESSSTAYMQLSSLASEDSAVYFCARRETTTVGRYYYAMDYW
  GQGTTVTVSSGGGGSDIKLQQSGAELARPGASVKMSCKTSGYTFTRYTMHWVKQRPGQGL
  EWIGYINPSRGYTNYNQKFKDKATLTTDKSSSTAYMQLSSLTSEDSAVYYCARYYDDHYC
  LDYWGQGTTLTVSSVEGGSGGSGGSGGSGGVDDIQLTQSPAIMSASPGEKVTMTCRASSS
  VSYMNWYQQKSGTSPKRWIYDTSKVASGVPYRFSGSGSGTSYSLTISSMEAEDAATYYCQ
  QWSSNPLTFGAGTKLELKHHHHHH
• ADMET Property:
  Half-life: The concentration or amount of drug in body reduced by one-half in 2.11 +/- 1.42 hours [4]
  Metabolism: The drug is metabolized via the catabolic pathways []
  Vd: The volume of distribution (Vd) of drug is 4.52 L []
• Cross-matching ID:
  DrugBank ID: DB09052
  TTD ID: D0K4RK
• Repurposed Drugs (RPD): Click to Jump to the Detailed RPD Information of This Drug

Molecular Interaction Atlas of This Drug

Drug Therapeutic Target (DTT)

DTT Name	DTT ID	UniProt ID	MOA	REF
B-lymphocyte surface antigen B4 (CD19)	TTW640A	CD19_HUMAN	Modulator	[5]
T-cell surface glycoprotein CD3 (CD3)	TTUN7MC	NOUNIPROTAC	Modulator	[5]

Molecular Expression Atlas of This Drug

• The Studied Disease: Acute lymphoblastic leukaemia
• ICD Disease Classification: 2A85

Molecule Name	Molecule Type	Gene Name	p-value	Fold-Change	Z-score
B-lymphocyte surface antigen B4 (CD19)	DTT	CD19	2.33E-24	-1.06	-1.33

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Disease Different from Blinatumomab (Comorbidity)

DDI Drug Name	DDI Drug ID	Severity	Mechanism	Comorbidity	REF
Remdesivir	DMBFZ6L	Moderate	Increased risk of hepatotoxicity by the combination of Blinatumomab and Remdesivir.	1D6YCoronavirus Disease 2019 [1D6YCoronavirus Disease 2019]	[6]
Oliceridine	DM6MDCF	Moderate	Decreased metabolism of Blinatumomab caused by Oliceridine mediated inhibition of CYP450 enzyme.	Acute pain [MG31]	[7]
Pexidartinib	DMS2J0Z	Major	Increased risk of hepatotoxicity by the combination of Blinatumomab and Pexidartinib.	Bone/articular cartilage neoplasm [2F7B]	[8]
Cannabidiol	DM0659E	Moderate	Increased risk of hepatotoxicity by the combination of Blinatumomab and Cannabidiol.	Epileptic encephalopathy [8A62]	[9]
Polyethylene glycol	DM4I1JP	Moderate	Increased risk of lowers seizure threshold by the combination of Blinatumomab and Polyethylene glycol.	Irritable bowel syndrome [DD91]	[10]
Calaspargase pegol	DMQZBXI	Moderate	Increased risk of hepatotoxicity by the combination of Blinatumomab and Calaspargase pegol.	Malignant haematopoietic neoplasm [2B33]	[11]
Idelalisib	DM602WT	Moderate	Increased risk of hepatotoxicity by the combination of Blinatumomab and Idelalisib.	Mature B-cell leukaemia [2A82]	[12]
Siponimod	DM2R86O	Major	Additive immunosuppressive effects by the combination of Blinatumomab and Siponimod.	Multiple sclerosis [8A40]	[6]
Ocrelizumab	DMEZ2KH	Moderate	Additive immunosuppressive effects by the combination of Blinatumomab and Ocrelizumab.	Multiple sclerosis [8A40]	[13]
Ozanimod	DMT6AM2	Major	Additive immunosuppressive effects by the combination of Blinatumomab and Ozanimod.	Multiple sclerosis [8A40]	[9]
Anthrax vaccine	DM9GSWY	Moderate	Antagonize the effect of Blinatumomab when combined with Anthrax vaccine.	Sepsis [1G40-1G41]	[14]

References

• [1] ClinicalTrials.gov (NCT02013167) Blinatumomab Versus Standard of Care Chemotherapy in Patients With Relapsed or Refractory Acute Lymphoblastic Leukemia (ALL)
• [2] Blinatumomab, a bispecific B-cell and T-cell engaging antibody, in the treatment of B-cell malignancies. Hum Vaccin Immunother. 2019;15(3):594-602.
• [3] Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
• [4] Trend Analysis of a Database of Intravenous Pharmacokinetic Parameters in Humans for 1352 Drug Compounds
• [5] 2014 FDA drug approvals. Nat Rev Drug Discov. 2015 Feb;14(2):77-81.
• [6] Cerner Multum, Inc. "Australian Product Information.".
• [7] Product Information. Blincyto (blinatumomab). Amgen USA, Thousand Oaks, CA.
• [8] Product Information. Turalio (pexidartinib). Daiichi Sankyo, Inc., Parsippany, NJ.
• [9] Cerner Multum, Inc. "UK Summary of Product Characteristics.".
• [10] Product Information. Suprep Bowel Prep Kit (magnesium/potassium/sodium sulfates). Braintree Laboratories, Braintree, MA.
• [11] Al-Nawakil C, Willems L, Mauprivez C, et.al "Successful treatment of l-asparaginase-induced severe acute hepatotoxicity using mitochondrial cofactors." Leuk Lymphoma 55 (2014): 1670-4. [PMID: 24090500]
• [12] Product Information. Zydelig (idelalisib). Gilead Sciences, Foster City, CA.
• [13] Product Information. Ocrevus (ocrelizumab). Genentech, South San Francisco, CA.
• [14] CDC. Centers for Disease Control and Prevention/ "Recommendations of the advisory committtee on immunization practices (ACIP): use of vaccines and immune globulins in persons with altered immunocompetence." MMWR Morb Mortal Wkly Rep 42(RR-04) (1993): 1-18. [PMID: 20300058]