Details of the Drug

General Information of Drug (ID: DMGECIJ)

Drug Name
Blinatumomab
Synonyms AMG 103; Blincyto
Indication
Disease Entry ICD 11 Status REF
Acute lymphoblastic leukaemia 2A85 Approved [1], [2]
Diffuse large B-cell lymphoma 2A81 Phase 2/3 [3]
Drug Type
Monoclonal antibody
Sequence
DIQLTQSPASLAVSLGQRATISCKASQSVDYDGDSYLNWYQQIPGQPPKLLIYDASNLVS
GIPPRFSGSGSGTDFTLNIHPVEKVDAATYHCQQSTEDPWTFGGGTKLEIKGGGGSGGGG
SGGGGSQVQLQQSGAELVRPGSSVKISCKASGYAFSSYWMNWVKQRPGQGLEWIGQIWPG
DGDTNYNGKFKGKATLTADESSSTAYMQLSSLASEDSAVYFCARRETTTVGRYYYAMDYW
GQGTTVTVSSGGGGSDIKLQQSGAELARPGASVKMSCKTSGYTFTRYTMHWVKQRPGQGL
EWIGYINPSRGYTNYNQKFKDKATLTTDKSSSTAYMQLSSLTSEDSAVYYCARYYDDHYC
LDYWGQGTTLTVSSVEGGSGGSGGSGGSGGVDDIQLTQSPAIMSASPGEKVTMTCRASSS
VSYMNWYQQKSGTSPKRWIYDTSKVASGVPYRFSGSGSGTSYSLTISSMEAEDAATYYCQ
QWSSNPLTFGAGTKLELKHHHHHH
ADMET Property
Half-life
The concentration or amount of drug in body reduced by one-half in 2.11 +/- 1.42 hours [4]
Metabolism
The drug is metabolized via the catabolic pathways [5]
Vd
The volume of distribution (Vd) of drug is 4.52 L [6]
Cross-matching ID
DrugBank ID
DB09052
TTD ID
D0K4RK

Molecular Interaction Atlas of This Drug


Drug Therapeutic Target (DTT)
DTT Name DTT ID UniProt ID MOA REF
B-lymphocyte surface antigen B4 (CD19) TTW640A CD19_HUMAN Modulator [7]
T-cell surface glycoprotein CD3 (CD3) TTUN7MC NOUNIPROTAC Modulator [7]
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This Drug

Molecular Expression Atlas of This Drug

The Studied Disease Acute lymphoblastic leukaemia
ICD Disease Classification 2A85
Molecule Name Molecule Type Gene Name p-value Fold-Change Z-score
B-lymphocyte surface antigen B4 (CD19) DTT CD19 2.33E-24 -1.06 -1.33
Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Disease Different from Blinatumomab (Comorbidity)
DDI Drug Name DDI Drug ID Severity Mechanism Comorbidity REF
Remdesivir DMBFZ6L Moderate Increased risk of hepatotoxicity by the combination of Blinatumomab and Remdesivir. 1D6YCoronavirus Disease 2019 [1D6YCoronavirus Disease 2019] [27]
Oliceridine DM6MDCF Moderate Decreased metabolism of Blinatumomab caused by Oliceridine mediated inhibition of CYP450 enzyme. Acute pain [MG31] [28]
Pexidartinib DMS2J0Z Major Increased risk of hepatotoxicity by the combination of Blinatumomab and Pexidartinib. Bone/articular cartilage neoplasm [2F7B] [29]
Cannabidiol DM0659E Moderate Increased risk of hepatotoxicity by the combination of Blinatumomab and Cannabidiol. Epileptic encephalopathy [8A62] [30]
Polyethylene glycol DM4I1JP Moderate Increased risk of lowers seizure threshold by the combination of Blinatumomab and Polyethylene glycol. Irritable bowel syndrome [DD91] [31]
Calaspargase pegol DMQZBXI Moderate Increased risk of hepatotoxicity by the combination of Blinatumomab and Calaspargase pegol. Malignant haematopoietic neoplasm [2B33] [32]
Idelalisib DM602WT Moderate Increased risk of hepatotoxicity by the combination of Blinatumomab and Idelalisib. Mature B-cell leukaemia [2A82] [33]
Siponimod DM2R86O Major Additive immunosuppressive effects by the combination of Blinatumomab and Siponimod. Multiple sclerosis [8A40] [27]
Ocrelizumab DMEZ2KH Moderate Additive immunosuppressive effects by the combination of Blinatumomab and Ocrelizumab. Multiple sclerosis [8A40] [34]
Ozanimod DMT6AM2 Major Additive immunosuppressive effects by the combination of Blinatumomab and Ozanimod. Multiple sclerosis [8A40] [30]
Anthrax vaccine DM9GSWY Moderate Antagonize the effect of Blinatumomab when combined with Anthrax vaccine. Sepsis [1G40-1G41] [35]
⏷ Show the Full List of 11 DDI Information of This Drug

References

1 ClinicalTrials.gov (NCT02013167) Blinatumomab Versus Standard of Care Chemotherapy in Patients With Relapsed or Refractory Acute Lymphoblastic Leukemia (ALL)
2 ClinicalTrials.gov (NCT02393859) Phase 3 Trial of Blinatumomab vs Standard Chemotherapy in Pediatric Subjects With HR First Relapse B-precursor ALL
3 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
4 Trend Analysis of a Database of Intravenous Pharmacokinetic Parameters in Humans for 1352 Drug Compounds
5 FDA approval: ado-trastuzumab emtansine for the treatment of patients with HER2-positive metastatic breast cancer. Clin Cancer Res. 2014 Sep 1;20(17):4436-41.
6 An FDA phase I clinical trial of quinacrine sterilization (QS). Int J Gynaecol Obstet. 2003 Oct;83 Suppl 2:S45-9.
7 2014 FDA drug approvals. Nat Rev Drug Discov. 2015 Feb;14(2):77-81.
8 2017 FDA drug approvals.Nat Rev Drug Discov. 2018 Feb;17(2):81-85.
9 Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services
10 Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services.
11 Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services. 2020
12 Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services.
13 Final results of a phase 1 study of loncastuximab tesirine in relapsed/refractory B-cell non-Hodgkin lymphoma. Blood. 2021 May 13;137(19):2634-2645.
14 A phase 1 trial of the Fc-engineered CD19 antibody XmAb5574 (MOR00208) demonstrates safety and preliminary efficacy in relapsed CLL. Blood. 2014 Dec 4;124(24):3553-60.
15 ClinicalTrials.gov (NCT03027739) CART-19 Cells For MRD Positive CD19+ ALL
16 ClinicalTrials.gov (NCT03391726) CART-19 Cells for R/R B-cell Lymphoma
17 Suppression of rheumatoid arthritis B cells by XmAb5871, an anti-CD19 antibody that coengages B cell antigen receptor complex and Fc receptor IIb inhibitory receptor.Arthritis Rheumatol.2014 May;66(5):1153-64.
18 Mitigating the risk of cytokine release syndrome in a Phase I trial of CD20/CD3 bispecific antibody mosunetuzumab in NHL: impact of translational system modeling. NPJ Syst Biol Appl. 2020 Aug 28;6(1):28.
19 Clinical pipeline report, company report or official report of Genmab.
20 Clinical pipeline report, company report or official report of Y-mAbs Therapeutics.
21 Low-dose otelixizumab anti-CD3 monoclonal antibody DEFEND-1 study: results of the randomized phase III study in recent-onset human type 1 diabetes.Diabetes Care.2014 Oct;37(10):2746-54.
22 A Mucin 16 bispecific T cell-engaging antibody for the treatment of ovarian cancer. Sci Transl Med. 2019 Jun 19;11(497):eaau7534.
23 DuoBody-CD3xCD20 induces potent T-cell-mediated killing of malignant B cells in preclinical models and provides opportunities for subcutaneous dosing. EBioMedicine. 2020 Feb;52:102625.
24 Clinical pipeline report, company report or official report of Ichnos Sciences.
25 Bispecific antibodies: a mechanistic review of the pipeline. Nat Rev Drug Discov. 2019 Aug;18(8):585-608.
26 A BCMAxCD3 bispecific T cell-engaging antibody demonstrates robust antitumor efficacy similar to that of anti-BCMA CAR T cells. Blood Adv. 2021 Mar 9;5(5):1291-1304.
27 Cerner Multum, Inc. "Australian Product Information.".
28 Product Information. Blincyto (blinatumomab). Amgen USA, Thousand Oaks, CA.
29 Product Information. Turalio (pexidartinib). Daiichi Sankyo, Inc., Parsippany, NJ.
30 Cerner Multum, Inc. "UK Summary of Product Characteristics.".
31 Product Information. Suprep Bowel Prep Kit (magnesium/potassium/sodium sulfates). Braintree Laboratories, Braintree, MA.
32 Al-Nawakil C, Willems L, Mauprivez C, et.al "Successful treatment of l-asparaginase-induced severe acute hepatotoxicity using mitochondrial cofactors." Leuk Lymphoma 55 (2014): 1670-4. [PMID: 24090500]
33 Product Information. Zydelig (idelalisib). Gilead Sciences, Foster City, CA.
34 Product Information. Ocrevus (ocrelizumab). Genentech, South San Francisco, CA.
35 CDC. Centers for Disease Control and Prevention/ "Recommendations of the advisory committtee on immunization practices (ACIP): use of vaccines and immune globulins in persons with altered immunocompetence." MMWR Morb Mortal Wkly Rep 42(RR-04) (1993): 1-18. [PMID: 20300058]