Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTWNL74)

DTT Name V-set and immunoglobulin domain-containing protein 9 (TIGIT)
Synonyms VSTM3; VSIG9; V-set and transmembrane domain-containing protein 3; T-cell immunoreceptor with Ig and ITIM domains
Gene Name TIGIT
DTT Type
Clinical trial target
 [1]
UniProt ID
TIGIT_HUMAN
TTD ID
T40874
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MRWCLLLIWAQGLRQAPLASGMMTGTIETTGNISAEKGGSIILQCHLSSTTAQVTQVNWE
QQDQLLAICNADLGWHISPSFKDRVAPGPGLGLTLQSLTVNDTGEYFCIYHTYPDGTYTG
RIFLEVLESSVAEHGARFQIPLLGAMAATLVVICTAVIVVVALTRKKKALRIHSVEGDLR
RKSAGQEEWSPSAPSPPGSCVQAEAAPAGLCGEQRGEDCAELHDYFNVLSYRSLGNCSFF
TETG
Function
Binds with high affinity to the poliovirus receptor (PVR) which causes increased secretion of IL10 and decreased secretion of IL12B and suppresses T-cell activation by promoting the generation of mature immunoregulatory dendritic cells.
KEGG Pathway
Cell adhesion molecules (CAMs) (hsa04514 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DTT
8 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
AB154 DMUES7Y Non-small-cell lung cancer 2C25 Phase 3 [2]
Ociperlimab DMEDSVJ Non-small-cell lung cancer 2C25.Y Phase 3 [3]
GSK4428859 DMIOIU8 Aggressive cancer 2A00-2F9Z Phase 2 [4]
Rilvegostomig DMDWCM2 Non-small-cell lung cancer 2C25 Phase 1/2 [5]
ASP8374 DMA71OL Solid tumour/cancer 2A00-2F9Z Phase 1 [1]
COM902 DMR6T8L Solid tumour/cancer 2A00-2F9Z Phase 1 [6]
M6223 DM6J085 Solid tumour/cancer 2A00-2F9Z Phase 1 [7]
SEA-TGT DM7GUH3 Solid tumour/cancer 2A00-2F9Z Phase 1 [8]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Clinical Trial Drug(s)

References

1 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
2 Clinical pipeline report, company report or official report of Arcus Biosciences.
3 Clinical pipeline report, company report or official report of BeiGene.
4 Clinical pipeline report, company report or official report of GlaxoSmithKline
5 ClinicalTrials.gov (NCT04995523) Phase I/II, Open-label, Dose Escalation and Dose Expansion Study to Evaluate Safety, Pharmacokinetics, Pharmacodynamics and Efficacy of AZD2936 Anti-TIGIT/Anti-PD-1 Bispecific Antibody in Participants With Advanced or Metastatic NSCLC. U.S.National Institutes of Health.
6 COM902, a novel therapeutic antibody targeting TIGIT augments anti-tumor T cell function in combination with PVRIG or PD-1 pathway blockade. Cancer Immunol Immunother. 2021 Apr 26.
7 ClinicalTrials.gov (NCT04457778) First in Human Study of M6223. U.S. National Institutes of Health.
8 Clinical pipeline report, company report or official report of Seagen.