Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TTYRO4F)

DTT Name	Sclerostin (SOST)
Synonyms	UNQ2976/PRO7455/PRO7476
Gene Name	SOST
DTT Type	Successful target	[1]
UniProt ID	SOST_HUMAN
TTD ID	T60724
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MQLPLALCLVCLLVHTAFRVVEGQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAE NGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIG RGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELK DFGTEAARPQKGRKPRPRARSAKANQAELENAY
Function	Negative regulator of bone growth that acts through inhibition of Wnt signaling and bone formation.
KEGG Pathway	Wnt signaling pathway (hsa04310 )
Reactome Pathway	Negative regulation of TCF-dependent signaling by WNT ligand antagonists (R-HSA-3772470 ) TCF dependent signaling in response to WNT (R-HSA-201681 )

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DTT

1 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Romosozumab	DMFJZN0	Postmenopausal osteoporosis	FB83.11	Approved	[2]
------------------------------------------------------------------------------------

4 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
UX143	DM89NIB	Osteogenesis imperfecta	LD24.K0	Phase 3	[3]
BPS-804	DMDYZRS	Metabolic bone disease	FB8Y	Phase 2	[4]
LY2541546	DMTVU2Q	Osteoporosis	FB83.0	Phase 2	[5]
AMG 167	DMUETI2	Osteoporosis	FB83.0	Phase 1	[6]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTT

Molecular Expression Atlas (MEA)

Jump to Detail Molecular Expression Atlas of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Osteoporosis	FA20	Bone marrow	1.11E-01	0.9	2.87
------------------------------------------------------------------------------------

References

1	Romosozumab in postmenopausal women with low bone mineral density. N Engl J Med. 2014 Jan 30;370(5):412-20.
2	Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services. 2019
3	Clinical pipeline report, company report or official report of Ultragenyx Pharmaceutical
4	WO patent application no. 2010,1001,79, Self-forming gel system for sustained drug delivery.
5	Rat-specific decreases in platelet count caused by a humanized monoclonal antibody against sclerostin. Toxicol Sci. 2012 Feb;125(2):586-94.
6	Osteoporosis - a current view of pharmacological prevention and treatment. Drug Des Devel Ther. 2013; 7: 435-448.