Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEFKGT7)

DME Name Metallothionein-2A (MT2A)
Synonyms Metallothionein-II; Metallothionein-2; MT-2; MT-II; MT2; MT2A
Gene Name MT2A
UniProt ID
MT2_HUMAN
INTEDE ID
DME0095
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
4502
EC Number EC: 1.8.5.1
Oxidoreductase
Sulfur donor oxidoreductase
Quinone acceptor oxidoreductase
EC: 1.8.5.1
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCC
A
Function This enzyme acts as anti-oxidants, protect against hydroxyl free radicals, are important in homeostatic control of metal in the cell, and play a role in detoxification of heavy metals.
KEGG Pathway
Mineral absorption (hsa04978 )
Reactome Pathway
Metallothioneins bind metals (R-HSA-5661231 )
Interferon gamma signaling (R-HSA-877300 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
3 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Carboplatin DMG281S Adenocarcinoma 2D40 Approved [1]
Cisplatin DMRHGI9 Adenocarcinoma 2D40 Approved [2]
Oxaliplatin DMQNWRD Adenocarcinoma 2D40 Approved [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 2.42E-15 5.58E-01 8.37E-01
Alopecia ED70 Skin from scalp 6.44E-01 1.24E-02 3.81E-02
Alzheimer's disease 8A20 Entorhinal cortex 1.77E-08 4.02E-01 5.09E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 8.20E-01 -1.53E-02 -3.10E-02
Aortic stenosis BB70 Calcified aortic valve 8.19E-01 2.19E-02 3.22E-02
Apnea 7A40 Hyperplastic tonsil 1.96E-01 -4.52E-01 -6.51E-01
Arthropathy FA00-FA5Z Peripheral blood 2.82E-01 -1.18E-01 -2.68E-01
Asthma CA23 Nasal and bronchial airway 6.21E-01 7.04E-03 9.50E-03
Atopic dermatitis EA80 Skin 1.64E-06 2.98E-01 2.14E+00
Autism 6A02 Whole blood 3.44E-03 -4.31E-01 -8.56E-01
Autoimmune uveitis 9A96 Peripheral monocyte 6.48E-03 -2.34E+00 -2.83E+00
Autosomal dominant monocytopenia 4B04 Whole blood 7.61E-02 1.51E+00 1.33E+00
Bacterial infection of gingival 1C1H Gingival tissue 1.40E-03 2.05E-01 5.26E-01
Batten disease 5C56.1 Whole blood 4.63E-01 2.43E-01 7.74E-01
Behcet's disease 4A62 Peripheral blood 1.07E-01 2.01E-01 7.91E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 1.21E-01 1.67E-01 3.60E-01
Bladder cancer 2C94 Bladder tissue 4.66E-02 9.89E-01 1.18E+00
Breast cancer 2C60-2C6Z Breast tissue 3.42E-07 -2.08E-01 -3.59E-01
Cardioembolic stroke 8B11.20 Whole blood 1.75E-03 1.78E-01 6.53E-01
Cervical cancer 2C77 Cervical tissue 6.56E-02 2.90E-01 6.86E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.48E-02 2.58E-01 4.21E-01
Chronic hepatitis C 1E51.1 Whole blood 7.30E-01 8.99E-02 2.11E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 3.06E-01 4.14E-01 4.67E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.70E-02 -3.12E-01 -6.96E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 4.17E-01 -3.38E-01 -5.81E-01
Colon cancer 2B90 Colon tissue 5.64E-58 -1.36E+00 -2.08E+00
Coronary artery disease BA80-BA8Z Peripheral blood 5.42E-01 5.69E-01 8.03E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.72E-01 -1.48E-01 -2.52E-01
Endometriosis GA10 Endometrium tissue 1.74E-03 2.22E+00 1.64E+00
Familial hypercholesterolemia 5C80.00 Peripheral blood 4.78E-02 -3.59E-01 -7.78E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.76E-05 -4.18E-01 -1.25E+00
Gastric cancer 2B72 Gastric tissue 5.59E-01 -1.32E-02 -8.85E-03
Glioblastopma 2A00.00 Nervous tissue 6.54E-04 4.06E-01 4.62E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 8.73E-03 -6.32E-01 -4.37E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 4.99E-04 7.35E-01 2.09E+00
Head and neck cancer 2D42 Head and neck tissue 5.73E-25 1.10E+00 1.97E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 3.09E-01 6.22E-02 1.30E-01
Huntington's disease 8A01.10 Whole blood 6.07E-01 1.19E-01 1.95E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 2.52E-02 -1.06E+00 -1.16E+00
Immunodeficiency 4A00-4A20 Peripheral blood 3.99E-08 7.32E-01 6.00E+00
Influenza 1E30 Whole blood 1.96E-01 7.26E-01 8.72E-01
Interstitial cystitis GC00.3 Bladder tissue 1.76E-03 9.73E-01 3.70E+00
Intracranial aneurysm 8B01.0 Intracranial artery 9.08E-01 2.97E-01 3.45E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.06E-01 -1.62E-01 -3.12E-01
Ischemic stroke 8B11 Peripheral blood 5.68E-01 3.36E-02 6.31E-02
Juvenile idiopathic arthritis FA24 Peripheral blood 1.03E-01 -2.13E-01 -3.16E-01
Lateral sclerosis 8B60.4 Skin 7.23E-01 -2.43E-02 -1.31E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 4.51E-01 1.12E+00 1.71E+00
Liver cancer 2C12.0 Liver tissue 3.41E-90 -2.14E+00 -8.67E+00
Liver failure DB99.7-DB99.8 Liver tissue 4.78E-03 -1.19E+00 -4.61E+00
Lung cancer 2C25 Lung tissue 1.17E-16 -5.17E-01 -6.92E-01
Lupus erythematosus 4A40 Whole blood 2.56E-06 7.56E-01 7.13E-01
Major depressive disorder 6A70-6A7Z Hippocampus 6.11E-01 -5.98E-02 -1.31E-01
Major depressive disorder 6A70-6A7Z Whole blood 6.55E-01 -1.37E-01 -4.04E-01
Melanoma 2C30 Skin 1.47E-01 2.14E-01 5.03E-01
Multiple myeloma 2A83.1 Peripheral blood 2.76E-01 9.81E-03 1.33E-02
Multiple myeloma 2A83.1 Bone marrow 3.05E-01 9.98E-02 3.29E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 5.06E-01 -2.45E-02 -7.99E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 4.94E-12 4.47E-01 1.21E+00
Myelofibrosis 2A20.2 Whole blood 8.92E-04 9.15E-01 3.14E+00
Myocardial infarction BA41-BA50 Peripheral blood 4.18E-04 3.08E-01 4.82E-01
Myopathy 8C70.6 Muscle tissue 3.04E-01 3.13E-01 3.66E-01
Neonatal sepsis KA60 Whole blood 1.53E-02 -1.91E-01 -4.70E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 3.62E-07 -1.31E+00 -2.92E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 1.01E-01 2.66E-01 9.17E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.38E-01 1.07E-01 5.92E-01
Olive pollen allergy CA08.00 Peripheral blood 1.17E-01 -1.11E+00 -1.33E+00
Oral cancer 2B6E Oral tissue 2.04E-03 3.80E-01 5.96E-01
Osteoarthritis FA00-FA0Z Synovial tissue 2.78E-01 9.80E-01 7.21E-01
Osteoporosis FB83.1 Bone marrow 4.49E-01 1.56E-02 4.60E-02
Ovarian cancer 2C73 Ovarian tissue 7.80E-01 3.95E-01 3.35E-01
Pancreatic cancer 2C10 Pancreas 7.84E-05 -9.55E-01 -1.31E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 1.33E-01 4.47E-01 6.96E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.22E-04 8.48E-01 1.92E+00
Pituitary cancer 2D12 Pituitary tissue 1.01E-02 -9.26E-01 -1.07E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 5.46E-02 -4.84E-01 -6.57E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 5.99E-02 -6.54E-02 -1.98E-01
Polycythemia vera 2A20.4 Whole blood 1.94E-16 6.69E-01 2.20E+00
Pompe disease 5C51.3 Biceps muscle 3.26E-01 5.28E-01 1.19E+00
Preterm birth KA21.4Z Myometrium 1.71E-02 -2.43E+00 -2.29E+00
Prostate cancer 2C82 Prostate 3.85E-04 -3.42E-01 -6.46E-01
Psoriasis EA90 Skin 1.27E-01 4.85E-02 1.40E-01
Rectal cancer 2B92 Rectal colon tissue 9.66E-05 -1.27E+00 -2.90E+00
Renal cancer 2C90-2C91 Kidney 1.14E-01 -8.15E-01 -6.98E-01
Retinoblastoma 2D02.2 Uvea 4.97E-01 -5.11E-01 -5.98E-01
Rheumatoid arthritis FA20 Synovial tissue 3.33E-04 1.40E+00 2.42E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 2.32E-02 9.55E-02 4.22E-01
Schizophrenia 6A20 Prefrontal cortex 1.93E-01 2.56E-01 3.35E-01
Schizophrenia 6A20 Superior temporal cortex 2.56E-01 4.11E-01 5.67E-01
Scleroderma 4A42.Z Whole blood 8.28E-01 -1.56E-01 -5.30E-01
Seizure 8A60-8A6Z Whole blood 3.18E-01 6.67E-01 5.35E-01
Sensitive skin EK0Z Skin 1.31E-01 1.38E-01 6.41E-01
Sepsis with septic shock 1G41 Whole blood 2.04E-03 -2.69E-01 -5.46E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 9.73E-01 3.04E-02 5.25E-02
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.23E-02 3.56E-01 1.27E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 1.61E-02 8.55E-01 4.69E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 2.01E-01 -5.47E-01 -1.59E+00
Skin cancer 2C30-2C3Z Skin 6.25E-04 2.18E-01 6.93E-01
Thrombocythemia 3B63 Whole blood 2.53E-07 5.55E-01 1.94E+00
Thrombocytopenia 3B64 Whole blood 9.12E-01 -1.09E-01 -1.10E-01
Thyroid cancer 2D10 Thyroid 2.21E-20 -7.32E-01 -1.59E+00
Tibial muscular dystrophy 8C75 Muscle tissue 1.45E-02 -5.78E-01 -9.62E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.56E-02 8.74E-01 2.12E+00
Type 2 diabetes 5A11 Liver tissue 5.28E-01 4.61E-02 4.03E-01
Ureter cancer 2C92 Urothelium 3.34E-01 4.80E-02 1.94E-01
Uterine cancer 2C78 Endometrium tissue 2.30E-03 -9.20E-02 -8.12E-02
Vitiligo ED63.0 Skin 4.12E-01 -3.58E-02 -1.68E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 PharmGKB: A worldwide resource for pharmacogenomic information. Wiley Interdiscip Rev Syst Biol Med. 2018 Jul;10(4):e1417. (ID: PA150642262)
2 Role of metallothionein in cisplatin sensitivity of germ-cell tumours. Int J Cancer. 2000 Mar 15;85(6):777-81.