General Information of Drug-Metabolizing Enzyme (DME) (ID: DEMQOF7)

DME Name Methionine-R-sulfoxide reductase B2 (MSRB2)
Synonyms Mitochondrial methionine-R-sulfoxide reductase B2; CBS-1; CGI-131; MSRB; MSRB2; MsrB2
Gene Name MSRB2
UniProt ID
MSRB2_HUMAN
INTEDE ID
DME0185
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
22921
EC Number EC: 1.8.4.12
Oxidoreductase
Sulfur donor oxidoreductase
Disulfide acceptor oxidoreductase
EC: 1.8.4.12
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MARLLWLLRGLTLGTAPRRAVRGQAGGGGPGTGPGLGEAGSLATCELPLAKSEWQKKLTP
EQFYVTREKGTEPPFSGIYLNNKEAGMYHCVCCDSPLFSSEKKYCSGTGWPSFSEAHGTS
GSDESHTGILRRLDTSLGSARTEVVCKQCEAHLGHVFPDGPGPNGQRFCINSVALKFKPR
KH
Function This enzyme specifically reduces methionine (R)-sulfoxide back to methionine.
Reactome Pathway
Protein repair (R-HSA-5676934 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
L-methionine DME8G1U Discovery agent N.A. Investigative [1]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 6.09E-02 -5.16E-02 -9.38E-02
Alopecia ED70 Skin from scalp 1.12E-03 2.24E-01 6.05E-01
Alzheimer's disease 8A20 Entorhinal cortex 7.48E-12 2.07E-01 7.97E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 4.20E-01 -4.05E-02 -2.15E-01
Aortic stenosis BB70 Calcified aortic valve 5.14E-01 -3.49E-01 -2.21E-01
Apnea 7A40 Hyperplastic tonsil 1.44E-01 5.73E-01 3.22E+00
Arthropathy FA00-FA5Z Peripheral blood 3.31E-02 6.32E-02 1.80E-01
Asthma CA23 Nasal and bronchial airway 8.74E-03 7.71E-02 8.03E-02
Atopic dermatitis EA80 Skin 7.73E-01 9.28E-02 1.82E-01
Autism 6A02 Whole blood 3.59E-01 -3.02E-01 -4.56E-01
Autoimmune uveitis 9A96 Peripheral monocyte 1.92E-03 7.11E-01 2.07E+00
Autosomal dominant monocytopenia 4B04 Whole blood 2.99E-01 -3.52E-01 -6.21E-01
Bacterial infection of gingival 1C1H Gingival tissue 3.02E-02 -1.09E-01 -2.09E-01
Batten disease 5C56.1 Whole blood 3.21E-01 -3.28E-01 -1.35E+00
Behcet's disease 4A62 Peripheral blood 4.76E-01 9.81E-02 1.67E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 9.70E-02 6.35E-02 4.45E-01
Bladder cancer 2C94 Bladder tissue 4.79E-07 -1.62E+00 -5.59E+00
Breast cancer 2C60-2C6Z Breast tissue 7.16E-14 -4.85E-01 -4.29E-01
Cardioembolic stroke 8B11.20 Whole blood 8.48E-10 7.19E-01 2.15E+00
Cervical cancer 2C77 Cervical tissue 3.27E-03 -7.19E-01 -1.17E+00
Childhood onset rheumatic disease FA20.Z Peripheral blood 8.30E-01 -2.36E-01 -2.66E-01
Chronic hepatitis C 1E51.1 Whole blood 2.86E-01 1.24E-01 5.54E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 2.81E-02 -1.86E-01 -4.92E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.05E-01 -3.09E-02 -5.85E-02
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.54E-01 -2.25E-01 -5.32E-01
Colon cancer 2B90 Colon tissue 4.70E-03 2.04E-01 3.89E-01
Coronary artery disease BA80-BA8Z Peripheral blood 6.29E-01 4.18E-01 5.68E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.62E-01 1.18E-01 1.57E-01
Endometriosis GA10 Endometrium tissue 5.19E-01 -1.07E+00 -1.42E+00
Familial hypercholesterolemia 5C80.00 Peripheral blood 4.09E-01 -8.07E-02 -2.98E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.72E-04 -5.00E-01 -1.01E+00
Gastric cancer 2B72 Gastric tissue 9.01E-01 5.44E-01 5.25E-01
Glioblastopma 2A00.00 Nervous tissue 6.70E-01 7.72E-02 1.34E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 1.52E-01 -4.95E-01 -1.97E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 7.39E-01 -5.98E-02 -1.01E-01
Head and neck cancer 2D42 Head and neck tissue 1.17E-08 -3.08E-01 -7.72E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 3.73E-01 1.03E-01 4.71E-01
Huntington's disease 8A01.10 Whole blood 2.94E-02 -2.99E-01 -7.41E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 3.98E-04 7.11E-01 2.83E+00
Immunodeficiency 4A00-4A20 Peripheral blood 2.86E-01 -6.05E-02 -2.91E-01
Influenza 1E30 Whole blood 3.52E-02 5.54E-01 2.47E+00
Interstitial cystitis GC00.3 Bladder tissue 9.34E-01 1.64E-02 5.89E-02
Intracranial aneurysm 8B01.0 Intracranial artery 7.81E-06 -1.29E+00 -2.09E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 1.26E-02 -1.38E-01 -4.91E-01
Ischemic stroke 8B11 Peripheral blood 3.16E-02 -1.93E-01 -4.64E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 5.55E-01 -7.69E-02 -1.22E-01
Lateral sclerosis 8B60.4 Skin 2.56E-01 -4.26E-01 -9.69E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 5.75E-02 -5.35E-01 -7.96E-01
Liver cancer 2C12.0 Liver tissue 8.28E-01 -1.32E-01 -2.18E-01
Liver failure DB99.7-DB99.8 Liver tissue 4.69E-02 1.03E-01 2.84E-01
Lung cancer 2C25 Lung tissue 2.13E-10 -4.94E-01 -7.42E-01
Lupus erythematosus 4A40 Whole blood 6.78E-02 -1.96E-01 -2.09E-01
Major depressive disorder 6A70-6A7Z Hippocampus 8.46E-01 -3.61E-02 -2.60E-01
Major depressive disorder 6A70-6A7Z Whole blood 6.23E-01 8.10E-03 2.05E-02
Melanoma 2C30 Skin 7.79E-01 -2.22E-01 -3.06E-01
Multiple myeloma 2A83.1 Peripheral blood 3.11E-01 3.56E-02 1.50E-01
Multiple myeloma 2A83.1 Bone marrow 8.35E-06 1.74E-01 1.91E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 4.26E-01 -1.66E-02 -1.57E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 2.08E-04 3.67E-01 7.42E-01
Myelofibrosis 2A20.2 Whole blood 1.37E-07 3.82E-01 1.67E+00
Myocardial infarction BA41-BA50 Peripheral blood 2.30E-01 3.88E-01 3.60E-01
Myopathy 8C70.6 Muscle tissue 3.78E-03 -5.42E-01 -1.52E+00
Neonatal sepsis KA60 Whole blood 2.82E-05 3.92E-01 6.38E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 2.41E-02 3.09E-01 5.67E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 4.34E-01 -6.79E-02 -3.47E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 3.35E-01 1.07E-01 2.57E-01
Olive pollen allergy CA08.00 Peripheral blood 8.89E-01 5.58E-02 8.75E-02
Oral cancer 2B6E Oral tissue 7.64E-02 -3.73E-01 -5.24E-01
Osteoarthritis FA00-FA0Z Synovial tissue 3.32E-01 -1.10E-01 -1.22E-01
Osteoporosis FB83.1 Bone marrow 9.42E-02 -1.41E-01 -5.15E-01
Ovarian cancer 2C73 Ovarian tissue 9.59E-04 -1.23E+00 -1.49E+00
Pancreatic cancer 2C10 Pancreas 5.30E-01 -4.69E-02 -6.76E-02
Parkinson's disease 8A00.0 Substantia nigra tissue 2.02E-01 1.25E-01 4.68E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 8.83E-03 2.17E-01 1.22E+00
Pituitary cancer 2D12 Pituitary tissue 2.87E-02 -3.68E-01 -9.27E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 4.55E-01 -2.41E-01 -5.21E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 9.72E-01 1.74E-01 9.16E-01
Polycythemia vera 2A20.4 Whole blood 9.09E-09 3.69E-01 1.44E+00
Pompe disease 5C51.3 Biceps muscle 8.73E-01 5.88E-02 2.40E-01
Preterm birth KA21.4Z Myometrium 9.52E-01 -1.34E-02 -2.04E-02
Prostate cancer 2C82 Prostate 2.68E-05 -1.12E+00 -1.79E+00
Psoriasis EA90 Skin 2.37E-11 -4.25E-01 -8.04E-01
Rectal cancer 2B92 Rectal colon tissue 6.66E-01 -1.14E-01 -6.08E-01
Renal cancer 2C90-2C91 Kidney 2.26E-02 1.28E-01 2.59E-01
Retinoblastoma 2D02.2 Uvea 1.30E-03 -6.41E-01 -3.74E+00
Rheumatoid arthritis FA20 Synovial tissue 4.18E-04 -1.34E+00 -2.27E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 9.29E-01 8.46E-03 5.96E-02
Schizophrenia 6A20 Prefrontal cortex 2.79E-01 -7.26E-02 -7.05E-02
Schizophrenia 6A20 Superior temporal cortex 6.03E-01 -8.54E-03 -5.43E-02
Scleroderma 4A42.Z Whole blood 5.21E-03 4.24E-01 1.34E+00
Seizure 8A60-8A6Z Whole blood 2.57E-01 1.17E-01 2.07E-01
Sensitive skin EK0Z Skin 6.32E-01 -1.39E-02 -5.60E-02
Sepsis with septic shock 1G41 Whole blood 7.26E-53 7.57E-01 1.67E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 3.43E-02 3.39E-01 1.66E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 8.29E-01 -5.21E-02 -1.98E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 1.03E-01 -5.28E-01 -1.54E+00
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.40E-01 6.90E-01 1.49E+00
Skin cancer 2C30-2C3Z Skin 1.95E-01 1.27E-01 2.30E-01
Thrombocythemia 3B63 Whole blood 3.40E-03 1.11E-01 4.57E-01
Thrombocytopenia 3B64 Whole blood 4.78E-01 0.00E+00 0.00E+00
Thyroid cancer 2D10 Thyroid 4.62E-30 -1.02E+00 -1.78E+00
Tibial muscular dystrophy 8C75 Muscle tissue 7.63E-02 -2.22E-01 -5.84E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 9.10E-02 2.70E-01 1.11E+00
Type 2 diabetes 5A11 Liver tissue 3.38E-01 -6.36E-02 -2.16E-01
Ureter cancer 2C92 Urothelium 2.35E-01 4.98E-02 1.93E-01
Uterine cancer 2C78 Endometrium tissue 2.39E-01 -4.32E-01 -5.36E-01
Vitiligo ED63.0 Skin 5.81E-02 -1.80E-01 -8.34E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 The X-ray structure of the N-terminal domain of PILB from Neisseria meningitidis reveals a thioredoxin-fold. J Mol Biol. 2006 Apr 28;358(2):443-54.