Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DENUPDX)

DME Name UDP-glucuronosyltransferase 2B4 (UGT2B4)
Synonyms UDP-glucuronosyltransferase family 2 member B4; Hyodeoxycholic acid-specific UDPGT; UDPGT 2B4; UDPGTh-1; UGT2B4
Gene Name UGT2B4
UniProt ID
UD2B4_HUMAN
INTEDE ID
DME0047
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
7363
EC Number EC: 2.4.1.17
Transferase
Glycosyltransferases
Hexosyltransferase
EC: 2.4.1.17
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MSMKWTSALLLIQLSCYFSSGSCGKVLVWPTEFSHWMNIKTILDELVQRGHEVTVLASSA
SISFDPNSPSTLKFEVYPVSLTKTEFEDIIKQLVKRWAELPKDTFWSYFSQVQEIMWTFN
DILRKFCKDIVSNKKLMKKLQESRFDVVLADAVFPFGELLAELLKIPFVYSLRFSPGYAI
EKHSGGLLFPPSYVPVVMSELSDQMTFIERVKNMIYVLYFEFWFQIFDMKKWDQFYSEVL
GRPTTLSETMAKADIWLIRNYWDFQFPHPLLPNVEFVGGLHCKPAKPLPKEMEEFVQSSG
ENGVVVFSLGSMVSNTSEERANVIASALAKIPQKVLWRFDGNKPDTLGLNTRLYKWIPQN
DLLGHPKTRAFITHGGANGIYEAIYHGIPMVGVPLFADQPDNIAHMKAKGAAVSLDFHTM
SSTDLLNALKTVINDPLYKENAMKLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAA
HDLTWFQYHSLDVTGFLLACVATVIFIITKCLFCVWKFVRTGKKGKRD
Function
This enzyme is active on polyhydroxylated estrogens (such as estriol, 4-hydroxyestrone and 2-hydroxyestriol) and xenobiotics (such as 4-methylumbelliferone, 1-naphthol, 4-nitrophenol, 2-aminophenol, 4-hydroxybiphenyl and menthol). It is also capable of 6 alpha- hydroxyglucuronidation of hyodeoxycholic acid.
KEGG Pathway
Ascorbate and aldarate metabolism (hsa00053 )
Bile secretion (hsa04976 )
Chemical carcinogenesis (hsa05204 )
Drug metabolism - cytochrome P450 (hsa00982 )
Drug metabolism - other enzymes (hsa00983 )
Metabolic pathways (hsa01100 )
Metabolism of xenobiotics by cytochrome P450 (hsa00980 )
Pentose and glucuronate interconversions (hsa00040 )
Porphyrin and chlorophyll metabolism (hsa00860 )
Retinol metabolism (hsa00830 )
Steroid hormone biosynthesis (hsa00140 )
Reactome Pathway
Glucuronidation (R-HSA-156588 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
4 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Canagliflozin DMFRM1I Non-insulin dependent diabetes 5A11 Approved [1]
Codeine DMJX6ZG Allergic rhinitis CA08.0 Approved [2]
Labetalol DMK8U72 Hypertension BA00-BA04 Approved [3]
Dihydrocodeine DMB0FWL Allergic rhinitis CA08.0 Phase 4 [4]
Experimental Enzyme Kinetic Data of Drugs
Drug Name Indication Highest Status Kinetic Data REF
Labetalol Hypertension [BA00-BA04] Approved Km = 0.368 microM [3]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 7.36E-01 -5.22E-03 -6.03E-02
Alopecia ED70 Skin from scalp 7.51E-01 4.32E-02 9.24E-02
Alzheimer's disease 8A20 Entorhinal cortex 3.49E-01 1.30E-02 1.49E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 1.09E-01 8.53E-02 8.81E-01
Aortic stenosis BB70 Calcified aortic valve 7.04E-01 2.76E-02 9.14E-02
Apnea 7A40 Hyperplastic tonsil 3.88E-01 2.28E-03 2.93E-02
Arthropathy FA00-FA5Z Peripheral blood 6.30E-01 0.00E+00 0.00E+00
Asthma CA23 Nasal and bronchial airway 2.33E-01 4.10E-02 1.39E-01
Atopic dermatitis EA80 Skin 4.93E-01 4.36E-03 5.87E-02
Autism 6A02 Whole blood 6.78E-02 -1.77E-02 -1.60E-01
Autoimmune uveitis 9A96 Peripheral monocyte 1.87E-01 -1.60E-01 -1.54E+00
Autosomal dominant monocytopenia 4B04 Whole blood 7.08E-01 9.86E-03 9.14E-02
Bacterial infection of gingival 1C1H Gingival tissue 6.37E-01 -1.47E-02 -1.92E-01
Batten disease 5C56.1 Whole blood 6.28E-01 5.47E-02 7.48E-01
Behcet's disease 4A62 Peripheral blood 1.36E-01 -8.89E-03 -5.18E-02
Bipolar disorder 6A60-6A6Z Prefrontal cortex 7.70E-01 -1.04E-03 -9.68E-03
Bladder cancer 2C94 Bladder tissue 8.08E-01 2.26E-02 8.35E-02
Breast cancer 2C60-2C6Z Breast tissue 1.43E-01 -1.07E-01 -1.52E-01
Cardioembolic stroke 8B11.20 Whole blood 5.78E-06 1.86E-01 1.63E+00
Cervical cancer 2C77 Cervical tissue 8.25E-01 -2.49E-02 -2.78E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.54E-01 -1.98E-02 -3.18E-01
Chronic hepatitis C 1E51.1 Whole blood 6.59E-01 -2.23E-02 -1.66E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 5.69E-01 -4.59E-02 -1.31E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 1.24E-01 -2.12E-02 -1.92E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 5.36E-01 -2.64E-02 -3.53E-01
Colon cancer 2B90 Colon tissue 4.63E-13 5.28E-02 4.44E-01
Coronary artery disease BA80-BA8Z Peripheral blood 3.89E-01 -1.26E-01 -4.55E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.98E-02 1.02E-01 9.68E-01
Endometriosis GA10 Endometrium tissue 9.75E-01 -5.52E-03 -5.49E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 2.04E-01 6.49E-02 1.02E+00
Familial hypercholesterolemia 5C80.00 Whole blood 3.79E-01 -5.37E-03 -6.34E-02
Gastric cancer 2B72 Gastric tissue 1.79E-01 1.93E-02 1.09E-01
Glioblastopma 2A00.00 Nervous tissue 2.09E-01 -5.14E-03 -4.90E-02
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 4.96E-01 -9.24E-03 -1.51E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 6.88E-02 -5.04E-02 -3.50E-01
Head and neck cancer 2D42 Head and neck tissue 1.03E-06 -5.33E-02 -3.71E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 5.54E-01 7.87E-03 7.74E-02
Huntington's disease 8A01.10 Whole blood 4.49E-01 -2.11E-02 -2.85E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 8.45E-01 -1.44E-02 -2.51E-02
Immunodeficiency 4A00-4A20 Peripheral blood 3.22E-01 5.80E-02 9.25E-01
Influenza 1E30 Whole blood 1.64E-01 5.06E-02 5.53E-01
Interstitial cystitis GC00.3 Bladder tissue 7.76E-01 1.43E-03 1.93E-02
Intracranial aneurysm 8B01.0 Intracranial artery 3.74E-01 0.00E+00 0.00E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 4.61E-01 -7.94E-03 -3.62E-02
Ischemic stroke 8B11 Peripheral blood 3.73E-01 1.57E-02 1.60E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.89E-01 1.21E-02 6.13E-02
Lateral sclerosis 8B60.4 Skin 2.17E-01 -3.88E-02 -8.93E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 5.50E-01 6.04E-02 3.96E-01
Liver cancer 2C12.0 Liver tissue 4.09E-14 -2.71E-01 -9.40E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.78E-02 -3.43E+00 -1.06E+01
Lung cancer 2C25 Lung tissue 5.86E-07 -3.97E-01 -6.84E-01
Lupus erythematosus 4A40 Whole blood 4.46E-01 2.15E-02 1.54E-01
Major depressive disorder 6A70-6A7Z Hippocampus 7.18E-01 -1.35E-02 -1.36E-01
Major depressive disorder 6A70-6A7Z Whole blood 9.68E-01 6.01E-03 2.84E-02
Melanoma 2C30 Skin 2.96E-03 -1.29E-01 -5.22E-01
Multiple myeloma 2A83.1 Peripheral blood 9.74E-01 -5.37E-02 -6.42E-01
Multiple myeloma 2A83.1 Bone marrow 2.19E-01 -7.10E-02 -7.33E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 7.26E-01 9.58E-02 7.40E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 1.47E-01 1.01E-02 1.30E-01
Myelofibrosis 2A20.2 Whole blood 4.91E-01 1.10E-02 9.79E-02
Myocardial infarction BA41-BA50 Peripheral blood 6.92E-01 4.91E-03 2.30E-02
Myopathy 8C70.6 Muscle tissue 3.30E-02 8.16E-02 1.05E+00
Neonatal sepsis KA60 Whole blood 5.37E-02 -2.54E-02 -2.29E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 1.74E-03 5.17E-02 8.27E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 4.39E-01 1.56E-01 3.80E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 5.36E-01 -2.09E-01 -4.60E-01
Olive pollen allergy CA08.00 Peripheral blood 5.62E-01 -2.74E-02 -7.44E-01
Oral cancer 2B6E Oral tissue 7.79E-01 2.18E-02 1.97E-01
Osteoarthritis FA00-FA0Z Synovial tissue 4.05E-01 -4.86E-02 -6.69E-01
Osteoporosis FB83.1 Bone marrow 4.85E-01 0.00E+00 0.00E+00
Ovarian cancer 2C73 Ovarian tissue 1.03E-01 -1.93E-02 -1.56E-01
Pancreatic cancer 2C10 Pancreas 4.76E-03 -1.17E-02 -1.29E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 6.17E-01 -2.88E-02 -3.38E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 1.18E-01 2.96E-02 4.36E-01
Pituitary cancer 2D12 Pituitary tissue 4.49E-01 1.30E-02 9.27E-02
Pituitary gonadotrope tumour 2D12 Pituitary tissue 7.89E-01 9.26E-03 6.23E-02
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 3.71E-01 -4.08E-02 -6.88E-01
Polycythemia vera 2A20.4 Whole blood 5.49E-01 -8.41E-03 -7.48E-02
Pompe disease 5C51.3 Biceps muscle 4.45E-01 2.35E-02 2.80E-01
Preterm birth KA21.4Z Myometrium 5.08E-01 -1.78E-02 -1.85E-01
Prostate cancer 2C82 Prostate 3.10E-11 5.15E-01 1.23E+00
Psoriasis EA90 Skin 5.01E-03 -4.33E-02 -3.79E-01
Rectal cancer 2B92 Rectal colon tissue 3.29E-01 -1.60E-01 -1.02E+00
Renal cancer 2C90-2C91 Kidney 3.54E-01 -3.06E-02 -2.10E-01
Retinoblastoma 2D02.2 Uvea 5.23E-01 2.65E-02 4.01E-01
Rheumatoid arthritis FA20 Synovial tissue 8.55E-02 -1.34E-01 -1.04E+00
Rhinovirus infection CA42.1 Nasal epithelium tissue 3.73E-01 1.69E-02 1.86E-01
Schizophrenia 6A20 Prefrontal cortex 5.54E-01 2.38E-02 2.12E-01
Schizophrenia 6A20 Superior temporal cortex 6.36E-01 3.04E-03 4.51E-02
Scleroderma 4A42.Z Whole blood 3.36E-01 2.65E-02 2.78E-01
Seizure 8A60-8A6Z Whole blood 8.75E-01 3.87E-02 4.60E-01
Sensitive skin EK0Z Skin 2.94E-01 -2.90E-02 -1.00E+00
Sepsis with septic shock 1G41 Whole blood 1.23E-02 -1.35E-02 -9.85E-02
Shwachman-Diamond syndrome 3A70.0 Bone marrow 4.01E-01 3.11E-04 4.55E-03
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.04E-01 4.55E-02 6.04E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 4.03E-01 5.12E-03 2.54E-02
Sjogren's syndrome 4A43.2 Salivary gland tissue 3.81E-01 -1.21E-02 -1.23E-01
Skin cancer 2C30-2C3Z Skin 1.58E-01 2.22E-02 1.64E-01
Thrombocythemia 3B63 Whole blood 7.79E-01 -4.67E-03 -4.40E-02
Thrombocytopenia 3B64 Whole blood 2.87E-01 -9.13E-02 -5.44E-01
Thyroid cancer 2D10 Thyroid 9.43E-01 2.97E-03 2.28E-02
Tibial muscular dystrophy 8C75 Muscle tissue 3.35E-01 1.14E-02 1.29E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 7.78E-01 -2.10E-02 -8.09E-01
Type 2 diabetes 5A11 Liver tissue 2.97E-01 1.44E-01 5.02E-01
Ureter cancer 2C92 Urothelium 9.30E-01 6.74E-03 6.54E-02
Uterine cancer 2C78 Endometrium tissue 7.37E-04 1.01E-02 1.07E-01
Vitiligo ED63.0 Skin 8.41E-01 -1.59E-02 -3.07E-02
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Effects of rifampin, cyclosporine A, and probenecid on the pharmacokinetic profile of canagliflozin, a sodium glucose co-transporter 2 inhibitor, in healthy participants. Int J Clin Pharmacol Ther. 2015 Feb;53(2):115-28.
2 Methadone inhibits CYP2D6 and UGT2B7/2B4 in vivo: a study using codeine in methadone- and buprenorphine-maintained subjects. Br J Clin Pharmacol. 2012 May;73(5):786-94.
3 Regulation of UDP-glucuronosyltransferase (UGT) 1A1 by progesterone and its impact on labetalol elimination. Xenobiotica. 2008 Jan;38(1):62-75.
4 Adult and infant pharmacokinetic profiling of dihydrocodeine using physiologically based pharmacokinetic modeling. Biopharm Drug Dispos. 2019 Nov;40(9):350-357.