Details of Drug-Metabolizing Enzyme (DME)
General Information of Drug-Metabolizing Enzyme (DME) (ID: DEYILK4)
DME Name | Cytidine deaminase (cdd) | ||||
---|---|---|---|---|---|
Synonyms | Cytidine aminohydrolase; Activation-induced cytidine deaminase; Canine hepatic cyd deaminase; AICDA; MHR_0312 | ||||
Gene Name | cdd | ||||
UniProt ID | |||||
INTEDE ID | |||||
EC Number | EC: 3.5.4.5 | ||||
Lineage |
Species: Mycoplasma hyorhinis |
||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MFQELEKLLKITYSPYSKFPVAAVIKDAKGNIWKGVNVENAAYPSGLCAERNALFSSITY
GFIPGKIQEIHILANTKEFIKPCAACLQVMIELMEYDADVYLYSITGAVEKRKLVEFLPL AFRKEFLN |
||||
Function |
This enzyme catalyzes the deamination of cytidine and 2'-deoxycytidine with similar efficiencies. It is involved in salvage of both exogenous and endogenous cytidine and 2'-deoxycytidine for UMP synthesis.
|
||||
KEGG Pathway | |||||
Molecular Interaction Atlas (MIA) of This DME
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
4 Approved Drug(s) Metabolized by This DME
|
||||||||||||||||||||||||||||||||||||||||||||||
Experimental Enzyme Kinetic Data of Drugs |
|
|||||||||||||||||||||||||||||||||||||||||||||