Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0I8XNI)

• DOT Name: Suppressor of tumorigenicity 7 protein-like (ST7L)
• Synonyms: ST7-related protein
• Gene Name: ST7L
• Related Disease:
  Cervical cancer
  Cervical carcinoma
  Epithelial ovarian cancer
  Hepatocellular carcinoma
  Neoplasm
  Advanced cancer
  Pancreatic cancer
  Breast cancer
  Breast carcinoma
• UniProt ID: ST7L_HUMAN
• Pfam ID: PF04184
• Sequence:
  MADRGGVGEAAAVGASPASVPGLNPTLGWRERLRAGLAGTGASLWFVAGLGLLYALRIPL
  RLCENLAAVTVFLNSLTPKFYVALTGTSSLISGLIFIFEWWYFHKHGTSFIEQVSVSHLQ
  PLMGGTESSISEPGSPSRNRENETSRQNLSECKVWRNPLNLFRGAEYRRYTWVTGKEPLT
  YYDMNLSAQDHQTFFTCDTDFLRPSDTVMQKAWRERNPPARIKAAYQALELNNDCATAYV
  LLAEEEATTIVDAERLFKQALKAGETIYRQSQQCQHQSPQHEAQLRRDTNVLVYIKRRLA
  MCARKLGRIREAVKIMRDLMKEFPPLTMLNIHENLLESLLELQAYPDVQAVLAKYDDISL
  PKSAAICYTAALLKTRTVSEKFSPETASRRGLSTAEINAVEAIHRAVEFNPHVPKYLLEM
  KSLILPPEHILKRGDSEAIAYAFFHLQHWKRIEGALNLLQCTWEGTFRMIPYPLEKGHLF
  YPYPSCTETADRELLPTFHHVSVYPKKELPLFIHFTAGFCSSTAMIAILTHQFPEIMGIF
  AKAVLGLWCPQPWASSGFEENTQDLKSEDLGLSSG

Molecular Interaction Atlas (MIA) of This DOT

9 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Cervical cancer	DISFSHPF	Definitive	Altered Expression	[1]
Cervical carcinoma	DIST4S00	Definitive	Altered Expression	[1]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[2]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[3]
Neoplasm	DISZKGEW	Strong	Biomarker	[4]
Advanced cancer	DISAT1Z9	moderate	Altered Expression	[1]
Pancreatic cancer	DISJC981	moderate	Biomarker	[5]
Breast cancer	DIS7DPX1	Limited	Biomarker	[4]
Breast carcinoma	DIS2UE88	Limited	Biomarker	[4]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Suppressor of tumorigenicity 7 protein-like (ST7L).	[6]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Suppressor of tumorigenicity 7 protein-like (ST7L).	[11]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Suppressor of tumorigenicity 7 protein-like (ST7L).	[7]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Suppressor of tumorigenicity 7 protein-like (ST7L).	[8]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Suppressor of tumorigenicity 7 protein-like (ST7L).	[9]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Suppressor of tumorigenicity 7 protein-like (ST7L).	[10]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Suppressor of tumorigenicity 7 protein-like (ST7L).	[12]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Suppressor of tumorigenicity 7 protein-like (ST7L).	[13]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Suppressor of tumorigenicity 7 protein-like (ST7L).	[14]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Suppressor of tumorigenicity 7 protein-like (ST7L).	[15]

References

• [1] miR-378 functions as an onco-miRNA by targeting the ST7L/Wnt/-catenin pathway in cervical cancer.Int J Mol Med. 2017 Oct;40(4):1047-1056. doi: 10.3892/ijmm.2017.3116. Epub 2017 Aug 30.
• [2] miR-23a promotes IKK expression but suppresses ST7L expression to contribute to the malignancy of epithelial ovarian cancer cells.Br J Cancer. 2016 Sep 6;115(6):731-40. doi: 10.1038/bjc.2016.244. Epub 2016 Aug 18.
• [3] Long noncoding RNA MIR31HG inhibits hepatocellular carcinoma proliferation and metastasis by sponging microRNA-575 to modulate ST7L expression.J Exp Clin Cancer Res. 2018 Sep 3;37(1):214. doi: 10.1186/s13046-018-0853-9.
• [4] Suppression of the proliferation and invasion of breast cancer cells by ST7L occurs through inhibition of activation of Wnt/GSK-3/-catenin signalling.Clin Exp Pharmacol Physiol. 2020 Jan;47(1):119-126. doi: 10.1111/1440-1681.13166. Epub 2019 Sep 9.
• [5] miR-331-3p functions as an oncogene by targeting ST7L in pancreatic cancer.Carcinogenesis. 2018 Jul 30;39(8):1006-1015. doi: 10.1093/carcin/bgy074.
• [6] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [7] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [8] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [9] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [10] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [11] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [12] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [13] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [14] Bisphenol A Exposure Changes the Transcriptomic and Proteomic Dynamics of Human Retinoblastoma Y79 Cells. Genes (Basel). 2021 Feb 11;12(2):264. doi: 10.3390/genes12020264.
• [15] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.