Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0MDL7K)

• DOT Name: Ribonucleoprotein PTB-binding 2 (RAVER2)
• Synonyms: Protein raver-2
• Gene Name: RAVER2
• Related Disease:
  Autoimmune disease
  Crohn disease
  Systemic lupus erythematosus
  Ulcerative colitis
  Central nervous system neoplasm
  Glioblastoma multiforme
  Glioma
• UniProt ID: RAVR2_HUMAN
• PDB ID: 1WG1
• Pfam ID: PF00076
• Sequence:
  MAAAAGDGGGEGGAGLGSAAGLGPGPGLRGQGPSAEAHEGAPDPMPAALHPEEVAARLQR
  MQRELSNRRKILVKNLPQDSNCQEVHDLLKDYDLKYCYVDRNKRTAFVTLLNGEQAQNAI
  QMFHQYSFRGKDLIVQLQPTDALLCITNVPISFTSEEFEELVRAYGNIERCFLVYSEVTG
  HSKGYGFVEYMKKDFAAKARLELLGRQLGASALFAQWMDVNLLASELIHSKCLCIDKLPS
  DYRDSEELLQIFSSVHKPVFCQLAQDEGSYVGGFAVVEYSTAEQAEEVQQAADGMTIKGS
  KVQVSFCAPGAPGRSTLAALIAAQRVMHSNQKGLLPEPNPVQIMKSLNNPAMLQVLLQPQ
  LCGRAVKPAVLGTPHSLPHLMNPSISPAFLHLNKAHQSSVMGNTSNLFLQNLSHIPLAQQ
  QLMKFENIHTNNKPGLLGEPPAVVLQTALGIGSVLPLKKELGHHHGEAHKTSSLIPTQTT
  ITAGMGMLPFFPNQHIAGQAGPGHSNTQEKQPATVGMAEGNFSGSQPYLQSFPNLAAGSL
  LVGHHKQQQSQPKGTEISSGAASKNQTSLLGEPPKEIRLSKNPYLNLASVLPSVCLSSPA
  SKTTLHKTGIASSILDAISQGSESQHALEKCIAYSPPFGDYAQVSSLRNEKRGSSYLISA
  PEGGSVECVDQHSQGTGAYYMETYLKKKRVY
• Function: May bind single-stranded nucleic acids.

Molecular Interaction Atlas (MIA) of This DOT

7 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Autoimmune disease	DISORMTM	Definitive	Genetic Variation	[1]
Crohn disease	DIS2C5Q8	Definitive	Genetic Variation	[1]
Systemic lupus erythematosus	DISI1SZ7	Definitive	Genetic Variation	[1]
Ulcerative colitis	DIS8K27O	Definitive	Genetic Variation	[1]
Central nervous system neoplasm	DISFC18W	Strong	Genetic Variation	[2]
Glioblastoma multiforme	DISK8246	Strong	Genetic Variation	[2]
Glioma	DIS5RPEH	Strong	Genetic Variation	[3]

10 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Ribonucleoprotein PTB-binding 2 (RAVER2).	[4]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Ribonucleoprotein PTB-binding 2 (RAVER2).	[5]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Ribonucleoprotein PTB-binding 2 (RAVER2).	[6]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Ribonucleoprotein PTB-binding 2 (RAVER2).	[7]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Ribonucleoprotein PTB-binding 2 (RAVER2).	[8]
Dasatinib	DMJV2EK	Approved	Dasatinib increases the expression of Ribonucleoprotein PTB-binding 2 (RAVER2).	[9]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Ribonucleoprotein PTB-binding 2 (RAVER2).	[10]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Ribonucleoprotein PTB-binding 2 (RAVER2).	[11]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Ribonucleoprotein PTB-binding 2 (RAVER2).	[12]
GALLICACID	DM6Y3A0	Investigative	GALLICACID decreases the expression of Ribonucleoprotein PTB-binding 2 (RAVER2).	[13]

References

• [1] Association of the RAVER2 gene with increased susceptibility for ulcerative colitis.Hum Immunol. 2012 Jul;73(7):732-5. doi: 10.1016/j.humimm.2012.04.018. Epub 2012 May 2.
• [2] Genome-wide association study of glioma subtypes identifies specific differences in genetic susceptibility to glioblastoma and non-glioblastoma tumors.Nat Genet. 2017 May;49(5):789-794. doi: 10.1038/ng.3823. Epub 2017 Mar 27.
• [3] Sex-specific glioma genome-wide association study identifies new risk locus at 3p21.31 in females, and finds sex-differences in risk at 8q24.21.Sci Rep. 2018 May 9;8(1):7352. doi: 10.1038/s41598-018-24580-z.
• [4] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [5] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [6] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [7] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [8] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [9] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [10] Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.
• [11] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [12] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [13] Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.