General Information of Drug Off-Target (DOT) (ID: OT13WAQX)

DOT Name Protein-arginine deiminase type-1 (PADI1)
Synonyms EC 3.5.3.15; Peptidylarginine deiminase I; Protein-arginine deiminase type I
Gene Name PADI1
Related Disease
Advanced cancer ( )
Alzheimer disease ( )
Arteriosclerosis ( )
Atherosclerosis ( )
Attention deficit hyperactivity disorder ( )
Behcet disease ( )
Hermansky-Pudlak syndrome ( )
High blood pressure ( )
Myopia ( )
Neoplasm ( )
Non-small-cell lung cancer ( )
Osteogenesis imperfecta ( )
Osteoporosis ( )
Peripheral arterial disease ( )
Peripheral vascular disease ( )
Schizophrenia ( )
Triple negative breast cancer ( )
Visceral leishmaniasis ( )
Amyotrophic lateral sclerosis ( )
Bacterial infection ( )
Hepatocellular carcinoma ( )
Hypoglycemia ( )
Plasma cell myeloma ( )
Type-1/2 diabetes ( )
Anxiety ( )
Anxiety disorder ( )
Breast cancer ( )
Breast carcinoma ( )
Depression ( )
Non-insulin dependent diabetes ( )
UniProt ID
PADI1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
5HP5
EC Number
3.5.3.15
Pfam ID
PF03068 ; PF08527 ; PF08526
Sequence
MAPKRVVQLSLKMPTHAVCVVGVEAHVDIHSDVPKGANSFRVSGSSGVEVFMVYNRTRVK
EPIGKARWPLDTDADMVVSVGTASKELKDFKVRVSYFGEQEDQALGRSVLYLTGVDISLE
VDTGRTGKVKRSQGDKKTWRWGPEGYGAILLVNCDRDNHRSAEPDLTHSWLMSLADLQDM
SPMLLSCNGPDKLFDSHKLVLNVPFSDSKRVRVFCARGGNSLSDYKQVLGPQCLSYEVER
QPGEQEIKFYVEGLTFPDADFLGLVSLSVSLVDPGTLPEVTLFTDTVGFRMAPWIMTPNT
QPPEELYVCRVMDTHGSNEKFLEDMSYLTLKANCKLTICPQVENRNDRWIQDEMEFGYIE
APHKSFPVVFDSPRNRGLKDFPYKRILGPDFGYVTREIPLPGPSSLDSFGNLDVSPPVTV
GGTEYPLGRILIGSSFPKSGGRQMARAVRNFLKAQQVQAPVELYSDWLSVGHVDEFLTFV
PTSDQKGFRLLLASPSACLKLFQEKKEEGYGEAAQFDGLKHQAKRSINEMLADRHLQRDN
LHAQKCIDWNRNVLKRELGLAESDIVDIPQLFFLKNFYAEAFFPDMVNMVVLGKYLGIPK
PYGPIINGRCCLEEKVQSLLEPLGLHCIFIDDYLSYHELQGEIHCGTNVRRKPFPFKWWN
MVP
Function Catalyzes the deimination of arginine residues of proteins.
Tissue Specificity Detected in epidermal keratinocytes (at protein level). Epidermis, prostate, testis, placenta, spleen and thymus.
Reactome Pathway
Chromatin modifying enzymes (R-HSA-3247509 )
BioCyc Pathway
MetaCyc:HS06945-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

30 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Advanced cancer DISAT1Z9 Strong Biomarker [1]
Alzheimer disease DISF8S70 Strong Biomarker [2]
Arteriosclerosis DISK5QGC Strong Genetic Variation [3]
Atherosclerosis DISMN9J3 Strong Genetic Variation [3]
Attention deficit hyperactivity disorder DISL8MX9 Strong Biomarker [4]
Behcet disease DISSYMBS Strong Biomarker [5]
Hermansky-Pudlak syndrome DISCY0HQ Strong Biomarker [6]
High blood pressure DISY2OHH Strong Biomarker [3]
Myopia DISK5S60 Strong Biomarker [7]
Neoplasm DISZKGEW Strong Biomarker [8]
Non-small-cell lung cancer DIS5Y6R9 Strong Altered Expression [9]
Osteogenesis imperfecta DIS7XQSD Strong Altered Expression [10]
Osteoporosis DISF2JE0 Strong Altered Expression [11]
Peripheral arterial disease DIS78WFB Strong Biomarker [12]
Peripheral vascular disease DISXSU1Y Strong Biomarker [12]
Schizophrenia DISSRV2N Strong Genetic Variation [13]
Triple negative breast cancer DISAMG6N Strong Biomarker [14]
Visceral leishmaniasis DISTKEYK Strong Biomarker [15]
Amyotrophic lateral sclerosis DISF7HVM moderate Genetic Variation [16]
Bacterial infection DIS5QJ9S moderate Genetic Variation [17]
Hepatocellular carcinoma DIS0J828 moderate Biomarker [18]
Hypoglycemia DISRCKR7 moderate Biomarker [19]
Plasma cell myeloma DIS0DFZ0 moderate Biomarker [20]
Type-1/2 diabetes DISIUHAP moderate Altered Expression [21]
Anxiety DISIJDBA Limited Genetic Variation [22]
Anxiety disorder DISBI2BT Limited Genetic Variation [22]
Breast cancer DIS7DPX1 Limited Biomarker [23]
Breast carcinoma DIS2UE88 Limited Biomarker [23]
Depression DIS3XJ69 Limited Genetic Variation [24]
Non-insulin dependent diabetes DISK1O5Z Limited Altered Expression [25]
------------------------------------------------------------------------------------
⏷ Show the Full List of 30 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Protein-arginine deiminase type-1 (PADI1). [26]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Protein-arginine deiminase type-1 (PADI1). [29]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Protein-arginine deiminase type-1 (PADI1). [30]
------------------------------------------------------------------------------------
3 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Protein-arginine deiminase type-1 (PADI1). [27]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Protein-arginine deiminase type-1 (PADI1). [28]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Protein-arginine deiminase type-1 (PADI1). [31]
------------------------------------------------------------------------------------

References

1 Expression of protein disulfide isomerase family members correlates with tumor progression and patient survival in ovarian cancer.Oncotarget. 2017 Oct 6;8(61):103543-103556. doi: 10.18632/oncotarget.21569. eCollection 2017 Nov 28.
2 Small Molecule Inhibition of Protein Disulfide Isomerase in Neuroblastoma Cells Induces an Oxidative Stress Response and Apoptosis Pathways.ACS Chem Neurosci. 2019 Sep 18;10(9):4068-4075. doi: 10.1021/acschemneuro.9b00301. Epub 2019 Aug 8.
3 Operational Differences in Plant-Based Diet Indices Affect the Ability to Detect Associations with Incident Hypertension in Middle-Aged US Adults.J Nutr. 2020 Apr 1;150(4):842-850. doi: 10.1093/jn/nxz275.
4 "When the Prescription Pad Is Not Enough": Attention-Deficit Hyperactivity Disorder Management 2.0.J Dev Behav Pediatr. 2017 Feb/Mar;38 Suppl 1:S32-S34. doi: 10.1097/DBP.0000000000000403.
5 One-Year Developmental Outcomes for Infants of Mothers With Bipolar Disorder.J Clin Psychiatry. 2017 Sep-Oct;78(8):1083-1090. doi: 10.4088/JCP.15m10535.
6 Defective PDI release from platelets and endothelial cells impairs thrombus formation in Hermansky-Pudlak syndrome.Blood. 2015 Mar 5;125(10):1633-42. doi: 10.1182/blood-2014-08-597419. Epub 2015 Jan 15.
7 Performance of a Quick Screening Version of the Nintendo 3DS PDI Check Game in Patients With Ocular Suppression.J Pediatr Ophthalmol Strabismus. 2019 Jul 1;56(4):234-237. doi: 10.3928/01913913-20190502-01.
8 Cancer-associated oxidoreductase ERO1- promotes immune escape through up-regulation of PD-L1 in human breast cancer.Oncotarget. 2017 Apr 11;8(15):24706-24718. doi: 10.18632/oncotarget.14960.
9 Combined expression of protein disulfide isomerase and endoplasmic reticulum oxidoreductin 1- is a poor prognostic marker for non-small cell lung cancer.Oncol Lett. 2018 Nov;16(5):5753-5760. doi: 10.3892/ol.2018.9339. Epub 2018 Aug 21.
10 NOVEL MUTATIONS IN THE WNT1, TMEM38B, P4HB, AND PLS3 GENES IN FOUR UNRELATED CHINESE FAMILIES WITH OSTEOGENESIS IMPERFECTA. Endocr Pract. 2019 Mar;25(3):230-241. doi: 10.4158/EP-2018-0443.
11 Regulation of ER molecular chaperone prevents bone loss in a murine model for osteoporosis.J Bone Miner Metab. 2010 Mar;28(2):131-8. doi: 10.1007/s00774-009-0117-z. Epub 2009 Sep 17.
12 Predictors of change in omega-3 index with fish oil supplementation in peripheral artery disease.J Surg Res. 2017 Apr;210:124-131. doi: 10.1016/j.jss.2016.11.011. Epub 2016 Nov 11.
13 Invariance of factor structure of the 21-item Peters et al. Delusions Inventory (PDI-21) over time and across samples.Psychiatry Res. 2017 Aug;254:190-197. doi: 10.1016/j.psychres.2017.04.053. Epub 2017 Apr 24.
14 PAD1 promotes epithelial-mesenchymal transition and metastasis in triple-negative breast cancer cells by regulating MEK1-ERK1/2-MMP2 signaling.Cancer Lett. 2017 Nov 28;409:30-41. doi: 10.1016/j.canlet.2017.08.019. Epub 2017 Aug 24.
15 Bioinformatics analysis of four proteins of Leishmania donovani to guide epitopes vaccine design and drug targets selection.Acta Trop. 2019 Mar;191:50-59. doi: 10.1016/j.actatropica.2018.12.035. Epub 2018 Dec 21.
16 ERp57 is protective against mutant SOD1-induced cellular pathology in amyotrophic lateral sclerosis.Hum Mol Genet. 2018 Apr 15;27(8):1311-1331. doi: 10.1093/hmg/ddy041.
17 Perylenediimide-based glycoclusters as high affinity ligands of bacterial lectins: synthesis, binding studies and anti-adhesive properties.Org Biomol Chem. 2017 Dec 6;15(47):10037-10043. doi: 10.1039/c7ob02749d.
18 Microvascular Flow Imaging of Residual or Recurrent Hepatocellular Carcinoma after Transarterial Chemoembolization: Comparison with Color/Power Doppler Imaging.Korean J Radiol. 2019 Jul;20(7):1114-1123. doi: 10.3348/kjr.2018.0932.
19 Anxiety affects disability and quality of life in patients with painful diabetic neuropathy.Eur J Pain. 2017 Nov;21(10):1632-1641. doi: 10.1002/ejp.1067. Epub 2017 Jun 27.
20 Tuning isoform selectivity and bortezomib sensitivity with a new class of alkenyl indene PDI inhibitor.Eur J Med Chem. 2020 Jan 15;186:111906. doi: 10.1016/j.ejmech.2019.111906. Epub 2019 Nov 21.
21 Transcriptional regulation of rat liver protein disulphide-isomerase gene by insulin and in diabetes.Biochem J. 1990 Apr 15;267(2):317-23. doi: 10.1042/bj2670317.
22 The pain course: a randomised controlled trial comparing a remote-delivered chronic pain management program when provided in online and workbook formats.Pain. 2017 Jul;158(7):1289-1301. doi: 10.1097/j.pain.0000000000000916.
23 Delivery of Amonafide from Fructose-Coated Nanodiamonds by Oxime Ligation for the Treatment of Human Breast Cancer.Biomacromolecules. 2018 Feb 12;19(2):481-489. doi: 10.1021/acs.biomac.7b01592. Epub 2018 Jan 23.
24 Posttraumatic stress disorder after minor trauma - A prospective cohort study.Med Hypotheses. 2020 Feb;135:109465. doi: 10.1016/j.mehy.2019.109465. Epub 2019 Nov 6.
25 Natural killer cell function, an important target for infection and tumor protection, is impaired in type 2 diabetes.PLoS One. 2013 Apr 25;8(4):e62418. doi: 10.1371/journal.pone.0062418. Print 2013.
26 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
27 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
28 Epidermal growth factor receptor signalling in human breast cancer cells operates parallel to estrogen receptor alpha signalling and results in tamoxifen insensitive proliferation. BMC Cancer. 2014 Apr 23;14:283.
29 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
30 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
31 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.