Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT15JFBR)

• DOT Name: Olfactomedin-like protein 1 (OLFML1)
• Gene Name: OLFML1
• UniProt ID: OLFL1_HUMAN
• Pfam ID: PF02191
• Sequence:
  MMVALRGASALLVLFLAAFLPPPQCTQDPAMVHYIYQRFRVLEQGLEKCTQATRAYIQEF
  QEFSKNISVMLGRCQTYTSEYKSAVGNLALRVERAQREIDYIQYLREADECIESEDKTLA
  EMLLQEAEEEKKIRTLLNASCDNMLMGIKSLKIVKKMMDTHGSWMKDAVYNSPKVYLLIG
  SRNNTVWEFANIRAFMEDNTKPAPRKQILTLSWQGTGQVIYKGFLFFHNQATSNEIIKYN
  LQKRTVEDRMLLPGGVGRALVYQHSPSTYIDLAVDEHGLWAIHSGPGTHSHLVLTKIEPG
  TLGVEHSWDTPCRSQDAEASFLLCGVLYVVYSTGGQGPHRITCIYDPLGTISEEDLPNLF
  FPKRPRSHSMIHYNPRDKQLYAWNEGNQIIYKLQTKRKLPLK
• Tissue Specificity: Mainly expressed in the small intestine, liver, lung and heart.

Molecular Interaction Atlas (MIA) of This DOT

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Olfactomedin-like protein 1 (OLFML1).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Olfactomedin-like protein 1 (OLFML1).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Olfactomedin-like protein 1 (OLFML1).	[3]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Olfactomedin-like protein 1 (OLFML1).	[5]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Olfactomedin-like protein 1 (OLFML1).	[6]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Olfactomedin-like protein 1 (OLFML1).	[7]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Olfactomedin-like protein 1 (OLFML1).	[8]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Olfactomedin-like protein 1 (OLFML1).	[9]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the mutagenesis of Olfactomedin-like protein 1 (OLFML1).	[10]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Olfactomedin-like protein 1 (OLFML1).	[11]
KOJIC ACID	DMP84CS	Investigative	KOJIC ACID decreases the expression of Olfactomedin-like protein 1 (OLFML1).	[12]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Olfactomedin-like protein 1 (OLFML1).	[4]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [3] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [4] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [5] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [6] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [7] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [8] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [9] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [10] Exome-wide mutation profile in benzo[a]pyrene-derived post-stasis and immortal human mammary epithelial cells. Mutat Res Genet Toxicol Environ Mutagen. 2014 Dec;775-776:48-54. doi: 10.1016/j.mrgentox.2014.10.011. Epub 2014 Nov 4.
• [11] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [12] Toxicogenomics of kojic acid on gene expression profiling of a375 human malignant melanoma cells. Biol Pharm Bull. 2006 Apr;29(4):655-69.