Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT1MY922)

• DOT Name: Protein PROCA1 (PROCA1)
• Synonyms: Protein interacting with cyclin A1
• Gene Name: PROCA1
• Related Disease:
  Advanced cancer
  Neoplasm
• UniProt ID: PRCA1_HUMAN
• Pfam ID: PF05826
• Sequence:
  MWVRTTLTIERWTKEKTEPKARSWDEALSDVNRLPSWERGHLLAGVASSTDVSTFSEGGD
  CKEPDKCCWRHKQCTGHIIYPFASDCVRHSLHLHSVNHCNCNSRLKDSSEDSSSSRGAGP
  TCSHVIESPCFELTPEEEHVERFRYGWCKSYRPVSVAVIHHPLYHECGADDLNEEEEEEE
  EESKPPIPTQVGPATASPDLGTSMATGTPDSTAPITIWRSESPTGKGQGSKVIKKVKKKK
  EKEKDKEEMDEKAKLKKKAKKGQLTKKKSPVKLEPSPPDVSRSLSARQLARMSESSPESR
  EELESEDSYNGRGQGELSSEDIVESSSPRKRENTVQAKKTGAKPSQARKVNKRKSPPGSN
  PNLS
• Tissue Specificity: High expressed in testis.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Limited	Biomarker	[1]
Neoplasm	DISZKGEW	Limited	Biomarker	[1]

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Protein PROCA1 (PROCA1).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Protein PROCA1 (PROCA1).	[3]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Protein PROCA1 (PROCA1).	[4]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Protein PROCA1 (PROCA1).	[5]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Protein PROCA1 (PROCA1).	[7]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Protein PROCA1 (PROCA1).	[8]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Protein PROCA1 (PROCA1).	[6]

References

• [1] GRPR-targeted Protein Contrast Agents for Molecular Imaging of Receptor Expression in Cancers by MRI.Sci Rep. 2015 Nov 18;5:16214. doi: 10.1038/srep16214.
• [2] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [3] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [4] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [5] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [7] MCM5 as a target of BET inhibitors in thyroid cancer cells. Endocr Relat Cancer. 2016 Apr;23(4):335-47. doi: 10.1530/ERC-15-0322. Epub 2016 Feb 24.
• [8] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.