Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT1NDPEL)

• DOT Name: Calcium/calmodulin-dependent protein kinase II inhibitor 2 (CAMK2N2)
• Synonyms: CaM-KII inhibitory protein; CaM-KIIN
• Gene Name: CAMK2N2
• Related Disease:
  Allergic asthma
  Mood disorder
• UniProt ID: CK2N2_HUMAN
• Pfam ID: PF15170
• Sequence:
  MSEILPYSEDKMGRFGADPEGSDLSFSCRLQDTNSFFAGNQAKRPPKLGQIGRAKRVVIE
  DDRIDDVLKGMGEKPPSGV
• Function: Potent and specific cellular inhibitor of CaM-kinase II (CAMK2). Traps Ca(2+)/calmodulin on CAMK2.
• Tissue Specificity: Highly Expressed in keyhole limpet hemocyanin-stimulated dendritic cell (DC) and weakly expressed in unstimulated mature and immature DC . Highly expressed in kidney and liver . Moderately expressed in heart, skeletal muscle, and placenta . Weakly expressed in the small intestine .

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Allergic asthma	DISHF0H3	Strong	Biomarker	[1]
Mood disorder	DISLVMWO	Strong	Altered Expression	[2]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Calcium/calmodulin-dependent protein kinase II inhibitor 2 (CAMK2N2).	[3]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Calcium/calmodulin-dependent protein kinase II inhibitor 2 (CAMK2N2).	[4]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Calcium/calmodulin-dependent protein kinase II inhibitor 2 (CAMK2N2).	[5]

References

• [1] Cationic CaMKII Inhibiting Nanoparticles Prevent Allergic Asthma.Mol Pharm. 2017 Jun 5;14(6):2166-2175. doi: 10.1021/acs.molpharmaceut.7b00114. Epub 2017 May 9.
• [2] The impact of body mass index in gene expression of reelin pathway mediators in individuals with schizophrenia and mood disorders: A post-mortem study.J Psychiatr Res. 2018 Jul;102:186-191. doi: 10.1016/j.jpsychires.2018.04.012. Epub 2018 Apr 13.
• [3] The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
• [4] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [5] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.