Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT26LRO2)

• DOT Name: O(6)-methylguanine-induced apoptosis 2 (STPG1)
• Synonyms: MAPO2; Sperm-tail PG-rich repeat-containing protein 1
• Gene Name: STPG1
• UniProt ID: STPG1_HUMAN
• Pfam ID: PF07004
• Sequence:
  MDNSAQKNERTGKHPRRASEVQKGFTAAYPTQSSIPFKSQASVIPESEKKGFNSQAKRFP
  HKKNDIPGPGFYNVIHQSPVSNSVSLSKKGTCMFPSMCARLDTIISKYPAANAYTIPSDF
  ISKRDFSNSCSSMFQLPSFMKALKFETPAPNYYNASVSCCKQRNNVCTRAGFMSKTQRGS
  FAFADKGPPPGHYDINESLVKQSPNTLMSCFKSKTNRGLKLTSTGPGPGYYNPSDCTKVP
  KKTLFPKNPILNFSAQPSPLPPKPPFPGPGQYEIVDYLGPRKHFISSASFVSNTSRWTAA
  PPQPGLPGPATYKPELPGKQSFLYNEDKKWIPVL
• Function: May positively contribute to the induction of apoptosis triggered by O(6)-methylguanine.

Molecular Interaction Atlas (MIA) of This DOT

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of O(6)-methylguanine-induced apoptosis 2 (STPG1).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of O(6)-methylguanine-induced apoptosis 2 (STPG1).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of O(6)-methylguanine-induced apoptosis 2 (STPG1).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of O(6)-methylguanine-induced apoptosis 2 (STPG1).	[4]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of O(6)-methylguanine-induced apoptosis 2 (STPG1).	[5]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of O(6)-methylguanine-induced apoptosis 2 (STPG1).	[7]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of O(6)-methylguanine-induced apoptosis 2 (STPG1).	[6]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [5] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [6] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [7] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.