Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2AT4N8)

• DOT Name: C-X-C motif chemokine 13 (CXCL13)
• Synonyms: Angie; B cell-attracting chemokine 1; BCA-1; B lymphocyte chemoattractant; CXC chemokine BLC; Small-inducible cytokine B13
• Gene Name: CXCL13
• UniProt ID: CXL13_HUMAN
• PDB ID: 5CBA; 5CBE; 6VGJ; 7JNY
• Pfam ID: PF00048
• Sequence:
  MKFISTSLLLMLLVSSLSPVQGVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGC
  PRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP
• Function: Chemotactic for B-lymphocytes but not for T-lymphocytes, monocytes and neutrophils. Does not induce calcium release in B-lymphocytes. Binds to BLR1/CXCR5.
• Tissue Specificity: Highest levels in liver, followed by spleen, lymph node, appendix and stomach. Low levels in salivary gland, mammary gland and fetal spleen.
• KEGG Pathway:
  Cytokine-cytokine receptor interaction (hsa04060)
  Viral protein interaction with cytokine and cytokine receptor (hsa04061)
  Chemokine sig.ling pathway (hsa04062)
• Reactome Pathway:
  G alpha (i) signalling events (R-HSA-418594)
  Chemokine receptors bind chemokines (R-HSA-380108)

Molecular Interaction Atlas (MIA) of This DOT

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of C-X-C motif chemokine 13 (CXCL13).	[1]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of C-X-C motif chemokine 13 (CXCL13).	[2]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of C-X-C motif chemokine 13 (CXCL13).	[3]
Mifepristone	DMGZQEF	Approved	Mifepristone decreases the expression of C-X-C motif chemokine 13 (CXCL13).	[4]
Tofacitinib	DMBS370	Approved	Tofacitinib decreases the expression of C-X-C motif chemokine 13 (CXCL13).	[5]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of C-X-C motif chemokine 13 (CXCL13).	[1]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of C-X-C motif chemokine 13 (CXCL13).	[6]
Aminohippuric acid	DMUN54G	Investigative	Aminohippuric acid affects the expression of C-X-C motif chemokine 13 (CXCL13).	[7]
MG149	DM7V58G	Investigative	MG149 decreases the expression of C-X-C motif chemokine 13 (CXCL13).	[8]

References

• [1] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [2] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [3] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [4] Mifepristone induced progesterone withdrawal reveals novel regulatory pathways in human endometrium. Mol Hum Reprod. 2007 Sep;13(9):641-54.
• [5] The JAK inhibitor tofacitinib suppresses synovial JAK1-STAT signalling in rheumatoid arthritis. Ann Rheum Dis. 2015 Jun;74(6):1311-6. doi: 10.1136/annrheumdis-2014-206028. Epub 2014 Nov 14.
• [6] Inhibition of Super-Enhancer Activity in Autoinflammatory Site-Derived T Cells Reduces Disease-Associated Gene Expression. Cell Rep. 2015 Sep 29;12(12):1986-96. doi: 10.1016/j.celrep.2015.08.046. Epub 2015 Sep 17.
• [7] Cancer-related proteins in serum are altered in workers occupationally exposed to polycyclic aromatic hydrocarbons: a cross-sectional study. Carcinogenesis. 2019 Jul 6;40(6):771-781. doi: 10.1093/carcin/bgz022.
• [8] KAT5 (Tip60) is a potential therapeutic target in malignant pleural mesothelioma. Int J Oncol. 2016 Mar;48(3):1290-6. doi: 10.3892/ijo.2016.3335. Epub 2016 Jan 13.