Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2G3YR1)

DOT Name	Bone morphogenetic protein 15 (BMP15)
Synonyms	BMP-15; Growth/differentiation factor 9B; GDF-9B
Gene Name	BMP15
Related Disease	Female hypogonadism ( ) Osteoporosis ( ) Ovarian dysgenesis 2 ( ) Ovarian dysgenesis 1 ( ) Ovarian hyperstimulation syndrome ( ) 46 XX gonadal dysgenesis ( )
UniProt ID	BMP15_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF00019
Sequence	MVLLSILRILFLCELVLFMEHRAQMAEGGQSSIALLAEAPTLPLIEELLEESPGEQPRKP RLLGHSLRYMLELYRRSADSHGHPRENRTIGATMVRLVKPLTNVARPHRGTWHIQILGFP LRPNRGLYQLVRATVVYRHHLQLTRFNLSCHVEPWVQKNPTNHFPSSEGDSSKPSLMSNA WKEMDITQLVQQRFWNNKGHRILRLRFMCQQQKDSGGLELWHGTSSLDIAFLLLYFNDTH KSIRKAKFLPRGMEEFMERESLLRRTRQADGISAEVTASSSKHSGPENNQCSLHPFQISF RQLGWDHWIIAPPFYTPNYCKGTCLRVLRDGLNSPNHAIIQNLINQLVDQSVPRPSCVPY KYVPISVLMIEANGSILYKEYEGMIAESCTCR
Function	May be involved in follicular development. Oocyte-specific growth/differentiation factor that stimulates folliculogenesis and granulosa cell (GC) growth.
KEGG Pathway	Cytokine-cytokine receptor interaction (hsa04060 ) Ovarian steroidogenesis (hsa04913 )
Reactome Pathway	Post-translational protein phosphorylation (R-HSA-8957275 ) Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) (R-HSA-381426 )

Molecular Interaction Atlas (MIA) of This DOT

6 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Female hypogonadism	DISWASB4	Strong	Biomarker	[1]
Osteoporosis	DISF2JE0	Strong	Genetic Variation	[2]
Ovarian dysgenesis 2	DISLHH9P	Strong	X-linked	[3]
Ovarian dysgenesis 1	DISXIXHW	moderate	Genetic Variation	[4]
Ovarian hyperstimulation syndrome	DIS4L94Y	moderate	Biomarker	[5]
46 XX gonadal dysgenesis	DISBB9HA	Supportive	Autosomal dominant	[6]
------------------------------------------------------------------------------------


⏷ Show the Full List of 6 Disease(s)

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Bone morphogenetic protein 15 (BMP15).	[7]
------------------------------------------------------------------------------------

References

1	The role of BMP15 and GDF9 in the pathogenesis of primary ovarian insufficiency.Hum Fertil (Camb). 2021 Dec;24(5):325-332. doi: 10.1080/14647273.2019.1672107. Epub 2019 Oct 14.
2	Estrogen-related genes and postmenopausal osteoporosis risk.Climacteric. 2012 Dec;15(6):587-93. doi: 10.3109/13697137.2012.656160. Epub 2012 Feb 15.
3	Synergistic roles of bone morphogenetic protein 15 and growth differentiation factor 9 in ovarian function. Mol Endocrinol. 2001 Jun;15(6):854-66. doi: 10.1210/mend.15.6.0662.
4	BMP15 mutations in XX gonadal dysgenesis and premature ovarian failure.Am J Obstet Gynecol. 2008 Jan;198(1):84.e1-5. doi: 10.1016/j.ajog.2007.05.029. Epub 2007 Sep 12.
5	A single nucleotide polymorphism in BMP15 is associated with high response to ovarian stimulation.Reprod Biomed Online. 2011 Jul;23(1):97-104. doi: 10.1016/j.rbmo.2011.02.015. Epub 2011 Mar 3.
6	Hypergonadotropic ovarian failure associated with an inherited mutation of human bone morphogenetic protein-15 (BMP15) gene. Am J Hum Genet. 2004 Jul;75(1):106-11. doi: 10.1086/422103. Epub 2004 May 10.
7	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.