Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2NSDT2)

• DOT Name: Glycosylated lysosomal membrane protein (GLMP)
• Synonyms: Lysosomal protein NCU-G1
• Gene Name: GLMP
• UniProt ID: GLMP_HUMAN
• Pfam ID: PF15065
• Sequence:
  MRGSVECTWGWGHCAPSPLLLWTLLLFAAPFGLLGEKTRQVSLEVIPNWLGPLQNLLHIR
  AVGTNSTLHYVWSSLGPLAVVMVATNTPHSTLSVNWSLLLSPEPDGGLMVLPKDSIQFSS
  ALVFTRLLEFDSTNVSDTAAKPLGRPYPPYSLADFSWNNITDSLDPATLSATFQGHPMND
  PTRTFANGSLAFRVQAFSRSSRPAQPPRLLHTADTCQLEVALIGASPRGNRSLFGLEVAT
  LGQGPDCPSMQEQHSIDDEYAPAVFQLDQLLWGSLPSGFAQWRPVAYSQKPGGRESALPC
  QASPLHPALAYSLPQSPIVRAFFGSQNNFCAFNLTFGASTGPGYWDQHYLSWSMLLGVGF
  PPVDGLSPLVLGIMAVALGAPGLMLLGGGLVLLLHHKKYSEYQSIN
• Function: Required to protect lysosomal transporter MFSD1 from lysosomal proteolysis and for MFSD1 lysosomal localization.

Molecular Interaction Atlas (MIA) of This DOT

12 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Glycosylated lysosomal membrane protein (GLMP).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Glycosylated lysosomal membrane protein (GLMP).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Glycosylated lysosomal membrane protein (GLMP).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Glycosylated lysosomal membrane protein (GLMP).	[4]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Glycosylated lysosomal membrane protein (GLMP).	[5]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Glycosylated lysosomal membrane protein (GLMP).	[6]
Hydroquinone	DM6AVR4	Approved	Hydroquinone decreases the expression of Glycosylated lysosomal membrane protein (GLMP).	[7]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Glycosylated lysosomal membrane protein (GLMP).	[8]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Glycosylated lysosomal membrane protein (GLMP).	[9]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Glycosylated lysosomal membrane protein (GLMP).	[10]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Glycosylated lysosomal membrane protein (GLMP).	[11]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Glycosylated lysosomal membrane protein (GLMP).	[12]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [4] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [5] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [6] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [7] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [8] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [9] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [10] Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
• [11] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [12] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.