Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT3B1RGG)

DOT Name	Ciliary neurotrophic factor receptor subunit alpha (CNTFR)
Synonyms	CNTF receptor subunit alpha; CNTFR-alpha
Gene Name	CNTFR
UniProt ID	CNTFR_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	1UC6; 8D74; 8D7E; 8D7H; 8D7R
Pfam ID	PF00041
Sequence	MAAPVPWACCAVLAAAAAVVYAQRHSPQEAPHVQYERLGSDVTLPCGTANWDAAVTWRVN GTDLAPDLLNGSQLVLHGLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNT YPKGFYCSWHLPTPTYIPNTFNVTVLHGSKIMVCEKDPALKNRCHIRYMHLFSTIKYKVS ISVSNALGHNATAITFDEFTIVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFPL KFFLRYRPLILDQWQHVELSDGTAHTITDAYAGKEYIIQVAAKDNEIGTWSDWSVAAHAT PWTEEPRHLTTEAQAAETTTSTTSSLAPPPTTKICDPGELGSGGGPSAPFLVSVPITLAL AAAAATASSLLI
Function	Binds to CNTF. The alpha subunit provides the receptor specificity. Receptor for heterodimeric neurotropic cytokine composed of CLCF1/CLC and CRLF1/CLF-1. Acts as a receptor for the neuroprotective peptide humanin as part of a complex with IL6ST/GP130 and IL27RA/WSX1.
Tissue Specificity	Nervous system and skeletal muscle.
KEGG Pathway	Cytokine-cytokine receptor interaction (hsa04060 ) JAK-STAT sig.ling pathway (hsa04630 )
Reactome Pathway	IL-6-type cytokine receptor ligand interactions (R-HSA-6788467 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Ciliary neurotrophic factor receptor subunit alpha (CNTFR).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Ciliary neurotrophic factor receptor subunit alpha (CNTFR).	[5]
------------------------------------------------------------------------------------

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Ciliary neurotrophic factor receptor subunit alpha (CNTFR).	[2]
Arsenic	DMTL2Y1	Approved	Arsenic decreases the expression of Ciliary neurotrophic factor receptor subunit alpha (CNTFR).	[3]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Ciliary neurotrophic factor receptor subunit alpha (CNTFR).	[2]
Cytarabine	DMZD5QR	Approved	Cytarabine increases the expression of Ciliary neurotrophic factor receptor subunit alpha (CNTFR).	[4]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Ciliary neurotrophic factor receptor subunit alpha (CNTFR).	[6]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Ciliary neurotrophic factor receptor subunit alpha (CNTFR).	[7]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Ciliary neurotrophic factor receptor subunit alpha (CNTFR).	[8]
------------------------------------------------------------------------------------


⏷ Show the Full List of 7 Drug(s)

References

1	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2	Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
3	Inorganic arsenic exposure promotes malignant progression by HDAC6-mediated down-regulation of HTRA1. J Appl Toxicol. 2023 Aug;43(8):1214-1224. doi: 10.1002/jat.4457. Epub 2023 Mar 11.
4	Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
5	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
6	Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
7	Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
8	Cellular reactions to long-term volatile organic compound (VOC) exposures. Sci Rep. 2016 Dec 1;6:37842. doi: 10.1038/srep37842.