General Information of Drug Off-Target (DOT) (ID: OT3K837P)

DOT Name Ragulator complex protein LAMTOR4 (LAMTOR4)
Synonyms Late endosomal/lysosomal adaptor and MAPK and MTOR activator 4
Gene Name LAMTOR4
UniProt ID
LTOR4_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
5VOK; 5X6U; 5X6V; 5Y38; 5Y39; 5Y3A; 5YK3; 5YK5; 6B9X; 6EHP; 6EHR; 6NZD; 6U62; 6ULG; 6WJ2; 6WJ3; 7T3A; 7T3B; 7T3C; 7UX2; 7UXC; 7UXH; 8DHB
Sequence
MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHRGMN
VPFKRLSVVFGEHTLLVTVSGQRVFVVKRQNRGREPIDV
Function
As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator plays a dual role for the small GTPases Rag (RagA/RRAGA, RagB/RRAGB, RagC/RRAGC and/or RagD/RRAGD): it (1) acts as a guanine nucleotide exchange factor (GEF), activating the small GTPases Rag and (2) mediates recruitment of Rag GTPases to the lysosome membrane. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated.
KEGG Pathway
mTOR sig.ling pathway (hsa04150 )
Reactome Pathway
MTOR signalling (R-HSA-165159 )
mTORC1-mediated signalling (R-HSA-166208 )
Energy dependent regulation of mTOR by LKB1-AMPK (R-HSA-380972 )
TP53 Regulates Metabolic Genes (R-HSA-5628897 )
Regulation of PTEN gene transcription (R-HSA-8943724 )
Amino acids regulate mTORC1 (R-HSA-9639288 )
Macroautophagy (R-HSA-1632852 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Ragulator complex protein LAMTOR4 (LAMTOR4). [1]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Ragulator complex protein LAMTOR4 (LAMTOR4). [2]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Ragulator complex protein LAMTOR4 (LAMTOR4). [3]
------------------------------------------------------------------------------------

References

1 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
2 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
3 Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.