General Information of Drug Off-Target (DOT) (ID: OT42C4HF)

DOT Name Homeobox protein Hox-A11 (HOXA11)
Synonyms Homeobox protein Hox-1I
Gene Name HOXA11
Related Disease
Radioulnar synostosis with amegakaryocytic thrombocytopenia 1 ( )
Radio-ulnar synostosis-amegakaryocytic thrombocytopenia syndrome ( )
UniProt ID
HXA11_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF12045 ; PF00046
Sequence
MDFDERGPCSSNMYLPSCTYYVSGPDFSSLPSFLPQTPSSRPMTYSYSSNLPQVQPVREV
TFREYAIEPATKWHPRGNLAHCYSAEELVHRDCLQAPSAAGVPGDVLAKSSANVYHHPTP
AVSSNFYSTVGRNGVLPQAFDQFFETAYGTPENLASSDYPGDKSAEKGPPAATATSAAAA
AAATGAPATSSSDSGGGGGCRETAAAAEEKERRRRPESSSSPESSSGHTEDKAGGSSGQR
TRKKRCPYTKYQIRELEREFFFSVYINKEKRLQLSRMLNLTDRQVKIWFQNRRMKEKKIN
RDRLQYYSANPLL
Function Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
KEGG Pathway
Transcriptio.l misregulation in cancer (hsa05202 )

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Radioulnar synostosis with amegakaryocytic thrombocytopenia 1 DIS18K7L Strong Autosomal dominant [1]
Radio-ulnar synostosis-amegakaryocytic thrombocytopenia syndrome DISBKMHA Supportive Autosomal dominant [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Homeobox protein Hox-A11 (HOXA11). [2]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the methylation of Homeobox protein Hox-A11 (HOXA11). [9]
------------------------------------------------------------------------------------
7 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Homeobox protein Hox-A11 (HOXA11). [3]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Homeobox protein Hox-A11 (HOXA11). [4]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of Homeobox protein Hox-A11 (HOXA11). [5]
Decitabine DMQL8XJ Approved Decitabine increases the expression of Homeobox protein Hox-A11 (HOXA11). [6]
Bortezomib DMNO38U Approved Bortezomib decreases the expression of Homeobox protein Hox-A11 (HOXA11). [7]
Tocopherol DMBIJZ6 Phase 2 Tocopherol increases the expression of Homeobox protein Hox-A11 (HOXA11). [8]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Homeobox protein Hox-A11 (HOXA11). [6]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Drug(s)

References

1 Amegakaryocytic thrombocytopenia and radio-ulnar synostosis are associated with HOXA11 mutation. Nat Genet. 2000 Dec;26(4):397-8. doi: 10.1038/82511.
2 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
4 Endocrine regulation of HOX genes. Endocr Rev. 2006 Jun;27(4):331-55. doi: 10.1210/er.2005-0018. Epub 2006 Apr 21.
5 Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
6 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
7 The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
8 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
9 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.