Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT44WWP5)

• DOT Name: Coiled-coil domain-containing protein 177 (CCDC177)
• Synonyms: Myelin proteolipid protein-like protein
• Gene Name: CCDC177
• UniProt ID: CC177_HUMAN
• Pfam ID: PF15558
• Sequence:
  MVDPVPEEEKAGAEPGDSGGDEAVASVPPDSQGAQEPAASSASASASAAVPRKAEVPCAA
  AEGGRREQSPLLHLDLFNFDCPEAEGSRYVLTSPRSLEACARCAVKPVELLPRALADLVR
  EAPGRSMRVATGLYEAYEAERRAKLQQCRAERERIMREEKRRLFTPLSPAAAAAAAAAAA
  SAPSAGSSSSCSSASLPASPAPRAARKASPSPSSARTQPPPAGSRTGRKSHSLDSLSRRR
  EGALSSESGASSSSYSGESLRELRWPPRASARNSCPAGSASSTTNAPGRPSALTLVPITG
  RSFSLGDLSHSPQTAQHVERIVRQVRAERGLRGVPERDRKIAALMLARHQEELLLLEQRA
  AAHGQWELQRVHAKQRREREEREKQRALEQGRRAWAAQVEERRGRRGREEREAARRRQRQ
  YERSEERRRELAERQGLLRRERAERAAREDRLRKLQQEQNLKQREEGLQEGRERAEQIRR
  ERAQRAARAKQRQEGQLQREKRELSRAERARHEALLQGRTRQQRQEREGLRSSLEASLGR
  AQENYEHLVEQRTRELRERARREELQGRRAKEAAERKEREHQAHLEALARAGERRLQHAT
  QVAEEAVQQKARRVGQSRLEKERAQRANKEKVERDEDCRRRELLQAIGRKLERSEQLTRE
  RRSALESARSTARASFHVREKVREETNTRSFDRMVREAQLHASLDRK

Molecular Interaction Atlas (MIA) of This DOT

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Coiled-coil domain-containing protein 177 (CCDC177).	[1]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Coiled-coil domain-containing protein 177 (CCDC177).	[3]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Coiled-coil domain-containing protein 177 (CCDC177).	[5]

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Coiled-coil domain-containing protein 177 (CCDC177).	[2]
Panobinostat	DM58WKG	Approved	Panobinostat decreases the expression of Coiled-coil domain-containing protein 177 (CCDC177).	[4]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Coiled-coil domain-containing protein 177 (CCDC177).	[4]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Coiled-coil domain-containing protein 177 (CCDC177).	[6]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Coiled-coil domain-containing protein 177 (CCDC177).	[4]
Paraoxon	DMN4ZKC	Investigative	Paraoxon decreases the expression of Coiled-coil domain-containing protein 177 (CCDC177).	[7]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [3] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [4] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [6] Comparison of transcriptome expression alterations by chronic exposure to low-dose bisphenol A in different subtypes of breast cancer cells. Toxicol Appl Pharmacol. 2019 Dec 15;385:114814. doi: 10.1016/j.taap.2019.114814. Epub 2019 Nov 9.
• [7] Genomic and phenotypic alterations of the neuronal-like cells derived from human embryonal carcinoma stem cells (NT2) caused by exposure to organophosphorus compounds paraoxon and mipafox. Int J Mol Sci. 2014 Jan 9;15(1):905-26. doi: 10.3390/ijms15010905.