Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT479VJV)

DOT Name	BH3-like motif-containing cell death inducer (BLID)
Synonyms	Breast cancer cell protein 2
Gene Name	BLID
Related Disease	Acute lymphocytic leukaemia ( ) Bone osteosarcoma ( ) Breast cancer ( ) Breast carcinoma ( ) Neoplasm ( ) Non-small-cell lung cancer ( ) Osteosarcoma ( ) Breast neoplasm ( ) Invasive breast carcinoma ( ) Advanced cancer ( ) Gastric cancer ( ) Pachyonychia congenita 3 ( ) Stomach cancer ( )
UniProt ID	BLID_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MVTLLPIEGQEIHFFEILESECVLYTGWIERASGSSIYPEAKARLPLEALLGSNKEPMLP KETVLSLKRYNLGSSAMKRNVPGHVLQRPSYLTRIQVTLLCNSSAEAL
Function	Functions as a proapoptotic molecule through the caspase-dependent mitochondrial pathway of cell death.
Tissue Specificity	Ubiquitously expressed.

Molecular Interaction Atlas (MIA) of This DOT

13 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Acute lymphocytic leukaemia	DISPX75S	Strong	Genetic Variation	[1]
Bone osteosarcoma	DIST1004	Strong	Biomarker	[2]
Breast cancer	DIS7DPX1	Strong	Biomarker	[3]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[3]
Neoplasm	DISZKGEW	Strong	Altered Expression	[4]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[4]
Osteosarcoma	DISLQ7E2	Strong	Biomarker	[2]
Breast neoplasm	DISNGJLM	Disputed	Genetic Variation	[5]
Invasive breast carcinoma	DISANYTW	Disputed	Genetic Variation	[5]
Advanced cancer	DISAT1Z9	Limited	Altered Expression	[3]
Gastric cancer	DISXGOUK	Limited	Biomarker	[6]
Pachyonychia congenita 3	DISZLC6C	Limited	Biomarker	[7]
Stomach cancer	DISKIJSX	Limited	Biomarker	[6]
------------------------------------------------------------------------------------


⏷ Show the Full List of 13 Disease(s)

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Microcystin-LR	DMTMLRN	Investigative	Microcystin-LR increases the expression of BH3-like motif-containing cell death inducer (BLID).	[8]
------------------------------------------------------------------------------------

References

1	MicroRNA-125b-1 and BLID upregulation resulting from a novel IGH translocation in childhood B-Cell precursor acute lymphoblastic leukemia.Genes Chromosomes Cancer. 2010 Aug;49(8):682-7. doi: 10.1002/gcc.20776.
2	MicroRNA-603 functions as an oncogene by suppressing BRCC2 protein translation in osteosarcoma.Oncol Rep. 2016 Jun;35(6):3257-64. doi: 10.3892/or.2016.4718. Epub 2016 Mar 30.
3	BLID: A Novel Tumor-Suppressor Gene.Oncol Res. 2014;22(5-6):333-8. doi: 10.3727/096504015X14410238486568.
4	MicroRNA-575 targets BLID to promote growth and invasion of non-small cell lung cancer cells.FEBS Lett. 2015 Mar 24;589(7):805-11. doi: 10.1016/j.febslet.2015.02.013. Epub 2015 Feb 26.
5	Frequent loss of the BLID gene in early-onset breast cancer.Cytogenet Genome Res. 2011;135(1):19-24. doi: 10.1159/000330265. Epub 2011 Aug 12.
6	A Novel Mechanism of Doxorubicin Resistance and Tumorigenesis Mediated by MicroRNA-501-5p-Suppressed BLID.Mol Ther Nucleic Acids. 2018 Sep 7;12:578-590. doi: 10.1016/j.omtn.2018.06.011. Epub 2018 Jul 5.
7	BRCC2, a novel BH3-like domain-containing protein, induces apoptosis in a caspase-dependent manner.J Biol Chem. 2004 Jun 18;279(25):26780-8. doi: 10.1074/jbc.M400159200. Epub 2004 Apr 6.
8	Gene expression network regulated by DNA methylation and microRNA during microcystin-leucine arginine induced malignant transformation in human hepatocyte L02 cells. Toxicol Lett. 2018 Jun 1;289:42-53. doi: 10.1016/j.toxlet.2018.03.003. Epub 2018 Mar 5.