Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT4AEIDJ)

• DOT Name: Transcription elongation factor A protein-like 3 (TCEAL3)
• Synonyms: TCEA-like protein 3; Transcription elongation factor S-II protein-like 3
• Gene Name: TCEAL3
• UniProt ID: TCAL3_HUMAN
• Pfam ID: PF04538
• Sequence:
  MEKPYNKNEGNLENEGKPEDEVEPDDEGKSDEEEKPDVEGKTECEGKREDEGEPGDEGQL
  EDEGSQEKQGRSEGEGKPQGEGKPASQAKPESQPRAAEKRPAEDYVPRKAKRKTDRGTDD
  SPKDSQEDLQERHLSSEEMMRECGDVSRAQEELRKKQKMGGFHWMQRDVQDPFAPRGQRG
  VRGVRGGGRGQRGLHDIPYL
• Function: May be involved in transcriptional regulation.

Molecular Interaction Atlas (MIA) of This DOT

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Transcription elongation factor A protein-like 3 (TCEAL3).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Transcription elongation factor A protein-like 3 (TCEAL3).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Transcription elongation factor A protein-like 3 (TCEAL3).	[3]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Transcription elongation factor A protein-like 3 (TCEAL3).	[5]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Transcription elongation factor A protein-like 3 (TCEAL3).	[6]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Transcription elongation factor A protein-like 3 (TCEAL3).	[7]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Transcription elongation factor A protein-like 3 (TCEAL3).	[8]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Transcription elongation factor A protein-like 3 (TCEAL3).	[9]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Transcription elongation factor A protein-like 3 (TCEAL3).	[10]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic increases the methylation of Transcription elongation factor A protein-like 3 (TCEAL3).	[4]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [4] Epigenetic changes in individuals with arsenicosis. Chem Res Toxicol. 2011 Feb 18;24(2):165-7. doi: 10.1021/tx1004419. Epub 2011 Feb 4.
• [5] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [6] Minimal peroxide exposure of neuronal cells induces multifaceted adaptive responses. PLoS One. 2010 Dec 17;5(12):e14352. doi: 10.1371/journal.pone.0014352.
• [7] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [8] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [9] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [10] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.