Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT4Q2922)

DOT Name Oxidoreductase-like domain-containing protein 1 (OXLD1)
Gene Name OXLD1
UniProt ID
OXLD1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF09791
Sequence
MLLRRVVEGGRAVAAAVRGSGARRFSSPDCCQRLPGGGSFLQRHHPGAQAPDGRRKFGTD
HVEVGSQAGADGTRPPKASLPPELQPPTNCCMSGCPNCVWVEYADRLLQHFQDGGERALA
ALEEHVADENLKAFLRMEIRLHTRCGG

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
4 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate affects the expression of Oxidoreductase-like domain-containing protein 1 (OXLD1). [1]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Oxidoreductase-like domain-containing protein 1 (OXLD1). [2]
Temozolomide DMKECZD Approved Temozolomide increases the expression of Oxidoreductase-like domain-containing protein 1 (OXLD1). [3]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Oxidoreductase-like domain-containing protein 1 (OXLD1). [4]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Oxidoreductase-like domain-containing protein 1 (OXLD1). [5]
------------------------------------------------------------------------------------

References

1 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
2 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
3 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
4 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
5 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.