Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT534FDX)

DOT Name	Cortexin-3 (CTXN3)
Synonyms	Kidney and brain-expressed protein
Gene Name	CTXN3
Related Disease	Alzheimer disease ( ) Mental disorder ( ) Schizophrenia ( )
UniProt ID	CTXN3_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF11057
Sequence	MDGGQPIPSSLVPLGNESADSSMSLEQKMTFVFVILLFIFLGILIVRCFRILLDPYRSMP TSTWADGLEGLEKGQFDHALA

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Alzheimer disease	DISF8S70	Strong	Biomarker	[1]
Mental disorder	DIS3J5R8	Strong	Biomarker	[2]
Schizophrenia	DISSRV2N	Strong	Genetic Variation	[2]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Cortexin-3 (CTXN3).	[3]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Cortexin-3 (CTXN3).	[5]
------------------------------------------------------------------------------------

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Cortexin-3 (CTXN3).	[4]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Cortexin-3 (CTXN3).	[4]
------------------------------------------------------------------------------------

References

1	KIBRA and APOE Gene Variants Affect Brain Functional Network Connectivity in Healthy Older People.J Gerontol A Biol Sci Med Sci. 2019 Oct 4;74(11):1725-1733. doi: 10.1093/gerona/glz004.
2	Association between 5q23.2-located polymorphism of CTXN3 gene (Cortexin 3) and schizophrenia in European-Caucasian males; implications for the aetiology of schizophrenia.Behav Brain Funct. 2015 Mar 17;11:10. doi: 10.1186/s12993-015-0057-9.
3	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
4	Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
5	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.