General Information of Drug Off-Target (DOT) (ID: OT5CE7LO)

DOT Name Neurochondrin (NCDN)
Gene Name NCDN
Related Disease
Cerebellar ataxia ( )
High blood pressure ( )
Neurodevelopmental disorder with infantile epileptic spasms ( )
Spinal muscular atrophy ( )
Autosomal recessive non-syndromic intellectual disability ( )
Type-1 diabetes ( )
UniProt ID
NCDN_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF05536
Sequence
MSCCDLAAAGQLGKASIMASDCEPALNQAEGRNPTLERYLGALREAKNDSEQFAALLLVT
KAVKAGDIDAKTRRRIFDAVGFTFPNRLLTTKEAPDGCPDHVLRALGVALLACFCSDPEL
AAHPQVLNKIPILSTFLTARGDPDDAARRSMIDDTYQCLTAVAGTPRGPRHLIAGGTVSA
LCQAYLGHGYGFDQALALLVGLLAAAETQCWKEAEPDLLAVLRGLSEDFQKAEDASKFEL
CQLLPLFLPPTTVPPECYRDLQAGLARILGSKLSSWQRNPALKLAARLAHACGSDWIPAG
SSGSKFLALLVNLACVEVRLALEETGTEVKEDVVTACYALMELGIQECTRCEQSLLKEPQ
KVQLVSVMKEAIGAVIHYLLQVGSEKQKEPFVFASVRILGAWLAEETSSLRKEVCQLLPF
LVRYAKTLYEEAEEANDLSQQVANLAISPTTPGPTWPGDALRLLLPGWCHLTVEDGPREI
LIKEGAPSLLCKYFLQQWELTSPGHDTSVLPDSVEIGLQTCCHIFLNLVVTAPGLIKRDA
CFTSLMNTLMTSLPALVQQQGRLLLAANVATLGLLMARLLSTSPALQGTPASRGFFAAAI
LFLSQSHVARATPGSDQAVLALSPEYEGIWADLQELWFLGMQAFTGCVPLLPWLAPAALR
SRWPQELLQLLGSVSPNSVKPEMVAAYQGVLVELARANRLCREAMRLQAGEETASHYRMA
ALEQCLSEP
Function
Probably involved in signal transduction in the nervous system, via increasing cell surface localization of GRM5/mGluR5 and positively regulating its signaling. Required for the spatial learning process. Acts as a negative regulator of Ca(2+)-calmodulin-dependent protein kinase 2 (CaMK2) phosphorylation. May play a role in modulating melanin-concentrating hormone-mediated functions via its interaction with MCHR1 that interferes with G protein-coupled signal transduction. May be involved in bone metabolism. May also be involved in neurite outgrowth (Probable).
Tissue Specificity Abundantly expressed in whole adult brain and in all individual brain regions examined, including spinal cord. Weakly expressed in ovary, testis, fetal brain and small intestine.

Molecular Interaction Atlas (MIA) of This DOT

6 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Cerebellar ataxia DIS9IRAV Strong Biomarker [1]
High blood pressure DISY2OHH Strong Biomarker [2]
Neurodevelopmental disorder with infantile epileptic spasms DIS7JC0O Strong Autosomal dominant [3]
Spinal muscular atrophy DISTLKOB Strong Biomarker [4]
Autosomal recessive non-syndromic intellectual disability DISJWRZZ Supportive Autosomal recessive [3]
Type-1 diabetes DIS7HLUB Limited Altered Expression [5]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Neurochondrin (NCDN). [6]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of Neurochondrin (NCDN). [14]
------------------------------------------------------------------------------------
8 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Neurochondrin (NCDN). [7]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Neurochondrin (NCDN). [8]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Neurochondrin (NCDN). [9]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Neurochondrin (NCDN). [10]
Selenium DM25CGV Approved Selenium increases the expression of Neurochondrin (NCDN). [11]
Tocopherol DMBIJZ6 Phase 2 Tocopherol increases the expression of Neurochondrin (NCDN). [11]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Neurochondrin (NCDN). [12]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide decreases the expression of Neurochondrin (NCDN). [13]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Drug(s)

References

1 Neurochondrin Antibody Serum Positivity in Three Cases of Autoimmune Cerebellar Ataxia.Cerebellum. 2019 Dec;18(6):1137-1142. doi: 10.1007/s12311-019-01048-y.
2 Evaluation of 12 Novel Molecular Markers for Degenerated Nucleus Pulposus in a Chinese Population.Spine (Phila Pa 1976). 2015 Aug 15;40(16):1252-60. doi: 10.1097/BRS.0000000000000929.
3 Monoallelic and bi-allelic variants in NCDN cause neurodevelopmental delay, intellectual disability, and epilepsy. Am J Hum Genet. 2021 Apr 1;108(4):739-748. doi: 10.1016/j.ajhg.2021.02.015. Epub 2021 Mar 11.
4 Neurochondrin interacts with the SMN protein suggesting a novel mechanism for spinal muscular atrophy pathology.J Cell Sci. 2018 Apr 17;131(8):jcs211482. doi: 10.1242/jcs.211482.
5 Comprehensive evaluation of differential lncRNA and gene expression in patients with intervertebral disc degeneration.Mol Med Rep. 2018 Aug;18(2):1504-1512. doi: 10.3892/mmr.2018.9128. Epub 2018 Jun 5.
6 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
7 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
8 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
9 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
10 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
11 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
12 Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
13 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
14 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.