Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT5HUSBG)

DOT Name	Dynein light chain Tctex-type protein 2B (DYNLT2B)
Synonyms	Tctex1 domain-containing protein 2
Gene Name	DYNLT2B
UniProt ID	DYT2B_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	8J07
Pfam ID	PF03645
Sequence	MATSIGVSFSVGDGVPEAEKNAGEPENTYILRPVFQQRFRPSVVKDCIHAVLKEELANAE YSPEEMPQLTKHLSENIKDKLKEMGFDRYKMVVQVVIGEQRGEGVFMASRCFWDADTDNY THDVFMNDSLFCVVAAFGCFYY
Function	Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 2 complex (dynein-2 complex), a motor protein complex that drives the movement of cargos along microtubules within cilia and flagella in concert with the intraflagellar transport (IFT) system. Required for proper retrograde ciliary transport.
Reactome Pathway	Intraflagellar transport (R-HSA-5620924 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Dynein light chain Tctex-type protein 2B (DYNLT2B).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Dynein light chain Tctex-type protein 2B (DYNLT2B).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Dynein light chain Tctex-type protein 2B (DYNLT2B).	[3]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Dynein light chain Tctex-type protein 2B (DYNLT2B).	[4]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Dynein light chain Tctex-type protein 2B (DYNLT2B).	[5]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Dynein light chain Tctex-type protein 2B (DYNLT2B).	[6]
------------------------------------------------------------------------------------


⏷ Show the Full List of 6 Drug(s)

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Dynein light chain Tctex-type protein 2B (DYNLT2B).	[7]
------------------------------------------------------------------------------------

References

1	Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2	Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
3	Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
4	Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
5	Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
6	Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
7	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.