General Information of Drug Off-Target (DOT) (ID: OT6AHPVG)

DOT Name Ribosome-recycling factor, mitochondrial (MRRF)
Synonyms RRF; mtRRF; Ribosome-releasing factor, mitochondrial
Gene Name MRRF
Related Disease
Cytochrome-c oxidase deficiency disease ( )
Mitochondrial trifunctional protein deficiency ( )
Myopathy ( )
UniProt ID
RRFM_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
6NU2; 6ZS9; 7L08; 7L20; 7NSH; 7NSI
Pfam ID
PF01765
Sequence
MALGLKCFRMVHPTFRNYLAASIRPVSEVTLKTVHERQHGHRQYMAYSAVPVRHFATKKA
KAKGKGQSQTRVNINAALVEDIINLEEVNEEMKSVIEALKDNFNKTLNIRTSPGSLDKIA
VVTADGKLALNQISQISMKSPQLILVNMASFPECTAAAIKAIRESGMNLNPEVEGTLIRV
PIPQVTREHREMLVKLAKQNTNKAKDSLRKVRTNSMNKLKKSKDTVSEDTIRLIEKQISQ
MADDTVAELDRHLAVKTKELLG
Function
Responsible for the disassembly of ribosomes from messenger RNA at the termination of mitochondrial protein biosynthesis. Acts in collaboration with GFM2. Promotes mitochondrial ribosome recycling by dissolution of intersubunit contacts.
Reactome Pathway
Mitochondrial translation termination (R-HSA-5419276 )

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Cytochrome-c oxidase deficiency disease DISK7N3G Strong Biomarker [1]
Mitochondrial trifunctional protein deficiency DIS2MYYR Strong Altered Expression [2]
Myopathy DISOWG27 Strong Altered Expression [3]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Ribosome-recycling factor, mitochondrial (MRRF). [4]
------------------------------------------------------------------------------------
5 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Ribosome-recycling factor, mitochondrial (MRRF). [5]
Vorinostat DMWMPD4 Approved Vorinostat increases the expression of Ribosome-recycling factor, mitochondrial (MRRF). [6]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN increases the expression of Ribosome-recycling factor, mitochondrial (MRRF). [7]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Ribosome-recycling factor, mitochondrial (MRRF). [8]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Ribosome-recycling factor, mitochondrial (MRRF). [9]
------------------------------------------------------------------------------------

References

1 Mitochondrial DNA depletion syndrome due to mutations in the RRM2B gene.Neuromuscul Disord. 2008 Jun;18(6):453-9. doi: 10.1016/j.nmd.2008.04.006. Epub 2008 May 27.
2 A diagnostic algorithm for metabolic myopathies.Curr Neurol Neurosci Rep. 2010 Mar;10(2):118-26. doi: 10.1007/s11910-010-0096-4.
3 Abnormal levels of human mitochondrial transcription factor A in skeletal muscle in mitochondrial encephalomyopathies.Neurol Sci. 2000;21(5 Suppl):S985-7. doi: 10.1007/s100720070017.
4 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
5 Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
6 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
7 Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
8 Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.
9 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.