Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT6VAFR8)

DOT Name Golgin subfamily A member 7B (GOLGA7B)
Gene Name GOLGA7B
Related Disease
Esophageal squamous cell carcinoma ( )
UniProt ID
GOG7B_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF10256
Sequence
MATEVHNLQELRRSASLATKVFIQRDYSDGTICQFQTKFPPELDSRIERQLFEETVKTLN
GFYAEAEKIGGSSYLEGCLACATAYFIFLCMETHYEKVLKKISRYIQEQNEKIFAPRGLL
LTDPVERGMRVIEISIYEDRCSSGSSSSGSSSGSGSSSGGGGGAGAR
Function Play a role in cell adhesion by regulating the plasma membrane localization of the palmitoyltransferase ZDHHC5. May be involved in protein transport from Golgi to cell surface.
Tissue Specificity Expressed in brain, but not in lung, nor chondrocytes.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Esophageal squamous cell carcinoma DIS5N2GV Strong Biomarker [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Golgin subfamily A member 7B (GOLGA7B). [2]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Golgin subfamily A member 7B (GOLGA7B). [4]
------------------------------------------------------------------------------------
4 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Triclosan DMZUR4N Approved Triclosan increases the expression of Golgin subfamily A member 7B (GOLGA7B). [3]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Golgin subfamily A member 7B (GOLGA7B). [5]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Golgin subfamily A member 7B (GOLGA7B). [6]
Acetaldehyde DMJFKG4 Investigative Acetaldehyde increases the expression of Golgin subfamily A member 7B (GOLGA7B). [7]
------------------------------------------------------------------------------------

References

1 Identification of genes associated with histologic tumor grade of esophageal squamous cell carcinoma.FEBS Open Bio. 2017 Jul 28;7(9):1246-1257. doi: 10.1002/2211-5463.12228. eCollection 2017 Sep.
2 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
4 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
5 Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
6 Comparison of transcriptome expression alterations by chronic exposure to low-dose bisphenol A in different subtypes of breast cancer cells. Toxicol Appl Pharmacol. 2019 Dec 15;385:114814. doi: 10.1016/j.taap.2019.114814. Epub 2019 Nov 9.
7 Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.