Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT6XISJD)

DOT Name	U2 small nuclear ribonucleoprotein B'' (SNRPB2)
Synonyms	U2 snRNP B''
Gene Name	SNRPB2
UniProt ID	RU2B_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	1A9N; 5MQF; 5O9Z; 5XJC; 5YZG; 5Z56; 5Z57; 5Z58; 6AH0; 6AHD; 6FF7; 6ICZ; 6ID0; 6ID1; 6QDV; 6QX9; 6Y53; 6Y5Q; 7A5P; 7ABG; 7ABI; 7EVO; 7VPX; 7W59; 7W5A; 7W5B; 8C6J; 8CH6; 8HK1
Pfam ID	PF00076
Sequence	MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELG SSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTT NKKPGQGTPNSANTQGNSTPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEV RLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK
Function	Involved in pre-mRNA splicing as component of the spliceosome. Associated with sn-RNP U2, where it contributes to the binding of stem loop IV of U2 snRNA.
KEGG Pathway	Spliceosome (hsa03040 )
Reactome Pathway	mRNA Splicing - Major Pathway (R-HSA-72163 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of U2 small nuclear ribonucleoprotein B'' (SNRPB2).	[1]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of U2 small nuclear ribonucleoprotein B'' (SNRPB2).	[2]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of U2 small nuclear ribonucleoprotein B'' (SNRPB2).	[3]
DTI-015	DMXZRW0	Approved	DTI-015 increases the expression of U2 small nuclear ribonucleoprotein B'' (SNRPB2).	[4]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of U2 small nuclear ribonucleoprotein B'' (SNRPB2).	[6]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of U2 small nuclear ribonucleoprotein B'' (SNRPB2).	[5]
------------------------------------------------------------------------------------

References

1	Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
2	Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
3	Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
4	Gene expression profile induced by BCNU in human glioma cell lines with differential MGMT expression. J Neurooncol. 2005 Jul;73(3):189-98.
5	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
6	Environmental pollutant induced cellular injury is reflected in exosomes from placental explants. Placenta. 2020 Jan 1;89:42-49. doi: 10.1016/j.placenta.2019.10.008. Epub 2019 Oct 17.