General Information of Drug Off-Target (DOT) (ID: OT7CQ24K)

DOT Name Myosin light chain 5 (MYL5)
Synonyms Myosin regulatory light chain 5; Superfast myosin regulatory light chain 2; MYLC2; MyLC-2
Gene Name MYL5
Related Disease
Cervical cancer ( )
Cervical carcinoma ( )
UniProt ID
MYL5_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF13499
Sequence
MASRKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYA
SLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKI
NKEYIKRLLMSQADKMTAEEVDQMFQFASIDVAGNLDYKALSYVITHGEEKEE
Tissue Specificity Expressed in fetal skeletal muscle and retina.
KEGG Pathway
Axon guidance (hsa04360 )
Focal adhesion (hsa04510 )
Adherens junction (hsa04520 )
Leukocyte transendothelial migration (hsa04670 )
Regulation of actin cytoskeleton (hsa04810 )
Motor proteins (hsa04814 )
Cytoskeleton in muscle cells (hsa04820 )
Shigellosis (hsa05131 )
Salmonella infection (hsa05132 )
Reactome Pathway
Smooth Muscle Contraction (R-HSA-445355 )

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Cervical cancer DISFSHPF Strong Altered Expression [1]
Cervical carcinoma DIST4S00 Strong Biomarker [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Myosin light chain 5 (MYL5). [2]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Myosin light chain 5 (MYL5). [11]
------------------------------------------------------------------------------------
12 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Myosin light chain 5 (MYL5). [3]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Myosin light chain 5 (MYL5). [4]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Myosin light chain 5 (MYL5). [5]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Myosin light chain 5 (MYL5). [6]
Testosterone enanthate DMB6871 Approved Testosterone enanthate affects the expression of Myosin light chain 5 (MYL5). [7]
Sodium lauryl sulfate DMLJ634 Approved Sodium lauryl sulfate increases the expression of Myosin light chain 5 (MYL5). [8]
Simvastatin DM30SGU Approved Simvastatin increases the expression of Myosin light chain 5 (MYL5). [9]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Myosin light chain 5 (MYL5). [10]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN increases the expression of Myosin light chain 5 (MYL5). [12]
3R14S-OCHRATOXIN A DM2KEW6 Investigative 3R14S-OCHRATOXIN A decreases the expression of Myosin light chain 5 (MYL5). [13]
Tributylstannanyl DMHN7CB Investigative Tributylstannanyl decreases the expression of Myosin light chain 5 (MYL5). [13]
Methyl Mercury Ion DM6YEW4 Investigative Methyl Mercury Ion affects the expression of Myosin light chain 5 (MYL5). [13]
------------------------------------------------------------------------------------
⏷ Show the Full List of 12 Drug(s)

References

1 The Bidirectional Regulation between MYL5 and HIF-1 Promotes Cervical Carcinoma Metastasis.Theranostics. 2017 Aug 23;7(15):3768-3780. doi: 10.7150/thno.20796. eCollection 2017.
2 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
4 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
5 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
7 Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
8 CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
9 A systems biology strategy reveals biological pathways and plasma biomarker candidates for potentially toxic statin-induced changes in muscle. PLoS One. 2006 Dec 20;1(1):e97. doi: 10.1371/journal.pone.0000097.
10 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
11 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
12 Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
13 Inhibition of CXCL12-mediated chemotaxis of Jurkat cells by direct immunotoxicants. Arch Toxicol. 2016 Jul;90(7):1685-94. doi: 10.1007/s00204-015-1585-7. Epub 2015 Aug 28.