General Information of Drug Off-Target (DOT) (ID: OT7LTW6K)

DOT Name Chondrosarcoma-associated gene 1 protein (CSAG1)
Synonyms Cancer/testis antigen 24.1; CT24.1; Cancer/testis antigen CSAGE
Gene Name CSAG1
Related Disease
Chondrosarcoma ( )
UniProt ID
CSAG1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MSATTACWPAFTVLGEARGDQVDWSRLYRDTGLVKMSRKPRASSPFSNNHPSTPKRFPRQ
PRREKGPVKEVPGTKGSP
Function May play an important role in maintaining centrosome integrity during mitosis.
Tissue Specificity Expressed in chondrosarcoma, melanoma, cartilage and testis, but not in other normal tissues.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Chondrosarcoma DIS4I7JB Strong Altered Expression [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Chondrosarcoma-associated gene 1 protein (CSAG1). [2]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Chondrosarcoma-associated gene 1 protein (CSAG1). [5]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Chondrosarcoma-associated gene 1 protein (CSAG1). [3]
Temozolomide DMKECZD Approved Temozolomide increases the expression of Chondrosarcoma-associated gene 1 protein (CSAG1). [4]
------------------------------------------------------------------------------------

References

1 Cancer/testis antigen CSAGE is concurrently expressed with MAGE in chondrosarcoma.Gene. 2002 Feb 20;285(1-2):269-78. doi: 10.1016/s0378-1119(02)00395-5.
2 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
4 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
5 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.