Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT8LJ550)

• DOT Name: Ankyrin repeat domain-containing protein 13C (ANKRD13C)
• Gene Name: ANKRD13C
• UniProt ID: AN13C_HUMAN
• Pfam ID: PF12796 ; PF11904
• Sequence:
  MTGEKIRSLRRDHKPSKEEGDLLEPGDEEAAAALGGTFTRSRIGKGGKACHKIFSNHHHR
  LQLKAAPASSNPPGAPALPLHNSSVTANSQSPALLAGTNPVAVVADGGSCPAHYPVHECV
  FKGDVRRLSSLIRTHNIGQKDNHGNTPLHLAVMLGNKECAHLLLAHNAPVKVKNAQGWSP
  LAEAISYGDRQMITALLRKLKQQSRESVEEKRPRLLKALKELGDFYLELHWDFQSWVPLL
  SRILPSDACKIYKQGINIRLDTTLIDFTDMKCQRGDLSFIFNGDAAPSESFVVLDNEQKV
  YQRIHHEESEMETEEEVDILMSSDIYSATLSTKSISFTRAQTGWLFREDKTERVGNFLAD
  FYLVNGLVLESRKRREHLSEEDILRNKAIMESLSKGGNIMEQNFEPIRRQSLTPPPQNTI
  TWEEYISAENGKAPHLGRELVCKESKKTFKATIAMSQEFPLGIELLLNVLEVVAPFKHFN
  KLREFVQMKLPPGFPVKLDIPVFPTITATVTFQEFRYDEFDGSIFTIPDDYKEDPSRFPD
  L
• Function: Acts as a molecular chaperone for G protein-coupled receptors, regulating their biogenesis and exit from the ER.

Molecular Interaction Atlas (MIA) of This DOT

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Ankyrin repeat domain-containing protein 13C (ANKRD13C).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Ankyrin repeat domain-containing protein 13C (ANKRD13C).	[2]
Indomethacin	DMSC4A7	Approved	Indomethacin decreases the expression of Ankyrin repeat domain-containing protein 13C (ANKRD13C).	[3]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Ankyrin repeat domain-containing protein 13C (ANKRD13C).	[4]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Ankyrin repeat domain-containing protein 13C (ANKRD13C).	[5]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Ankyrin repeat domain-containing protein 13C (ANKRD13C).	[6]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of Ankyrin repeat domain-containing protein 13C (ANKRD13C).	[7]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Ankyrin repeat domain-containing protein 13C (ANKRD13C).	[8]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Ankyrin repeat domain-containing protein 13C (ANKRD13C).	[9]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Mechanisms of indomethacin-induced alterations in the choline phospholipid metabolism of breast cancer cells. Neoplasia. 2006 Sep;8(9):758-71.
• [4] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [5] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [6] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [7] The genomic response of Ishikawa cells to bisphenol A exposure is dose- and time-dependent. Toxicology. 2010 Apr 11;270(2-3):137-49. doi: 10.1016/j.tox.2010.02.008. Epub 2010 Feb 17.
• [8] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [9] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.