Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT970EYO)

• DOT Name: SAP30-binding protein (SAP30BP)
• Synonyms: Transcriptional regulator protein HCNGP
• Gene Name: SAP30BP
• Related Disease:
  Glioma
  Schizophrenia
• UniProt ID: S30BP_HUMAN
• Pfam ID: PF07818
• Sequence:
  MAGKKNVLSSLAVYAEDSEPESDGEAGIEAVGSAAEEKGGLVSDAYGEDDFSRLGGDEDG
  YEEEEDENSRQSEDDDSETEKPEADDPKDNTEAEKRDPQELVASFSERVRNMSPDEIKIP
  PEPPGRCSNHLQDKIQKLYERKIKEGMDMNYIIQRKKEFRNPSIYEKLIQFCAIDELGTN
  YPKDMFDPHGWSEDSYYEALAKAQKIEMDKLEKAKKERTKIEFVTGTKKGTTTNATSTTT
  TTASTAVADAQKRKSKWDSAIPVTTIAQPTILTTTATLPAVVTVTTSASGSKTTVISAVG
  TIVKKAKQ
• Function: Plays a role in transcriptional repression by promoting histone deacetylase activity, leading to deacetylation of histone H3. May be involved in the regulation of beta-2-microglobulin genes; (Microbial infection) Involved in transcriptional repression of HHV-1 genes TK and gC.
• Reactome Pathway: NoRC negatively regulates rRNA expression (R-HSA-427413)

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Glioma	DIS5RPEH	Definitive	Biomarker	[1]
Schizophrenia	DISSRV2N	Strong	Biomarker	[2]

6 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of SAP30-binding protein (SAP30BP).	[3]
Quercetin	DM3NC4M	Approved	Quercetin increases the phosphorylation of SAP30-binding protein (SAP30BP).	[8]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of SAP30-binding protein (SAP30BP).	[10]
TAK-243	DM4GKV2	Phase 1	TAK-243 decreases the sumoylation of SAP30-binding protein (SAP30BP).	[11]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of SAP30-binding protein (SAP30BP).	[8]
Coumarin	DM0N8ZM	Investigative	Coumarin decreases the phosphorylation of SAP30-binding protein (SAP30BP).	[8]

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of SAP30-binding protein (SAP30BP).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of SAP30-binding protein (SAP30BP).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of SAP30-binding protein (SAP30BP).	[6]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of SAP30-binding protein (SAP30BP).	[7]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of SAP30-binding protein (SAP30BP).	[9]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of SAP30-binding protein (SAP30BP).	[12]

References

• [1] Targeting human glioma cells using HSV-1 amplicon peptide display vector.Gene Ther. 2010 Feb;17(2):250-60. doi: 10.1038/gt.2009.128. Epub 2009 Oct 8.
• [2] Exome sequencing supports a de novo mutational paradigm for schizophrenia.Nat Genet. 2011 Aug 7;43(9):864-8. doi: 10.1038/ng.902.
• [3] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [4] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [5] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [6] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [7] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [8] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [9] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [10] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [11] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [12] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.