Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT9QUFL3)

• DOT Name: Mucin-like protein 1 (MUCL1)
• Synonyms: Protein BS106; Small breast epithelial mucin
• Gene Name: MUCL1
• Related Disease:
  Advanced cancer
  Breast cancer
  Breast carcinoma
  Esophageal adenocarcinoma
  Esophageal squamous cell carcinoma
  Neoplasm
  Breast neoplasm
• UniProt ID: MUCL1_HUMAN
• Sequence:
  MKFLAVLVLLGVSIFLVSAQNPTTAAPADTYPATGPADDEAPDAETTAAATTATTAAPTT
  ATTAASTTARKDIPVLPKWVGDLPNGRVCP
• Function: May play a role as marker for the diagnosis of metastatic breast cancer.
• Tissue Specificity: Expressed in mammary, salivary glands and prostate. Also detected in lung. Mainly expressed in cancer cell lines of breast origin. Highly expressed in lymph node-positive compared with node-negative tumors. Detected in all lymph node containing metastatic cells.
• Reactome Pathway:
  Defective C1GALT1C1 causes TNPS (R-HSA-5083632)
  Defective GALNT12 causes CRCS1 (R-HSA-5083636)
  Dectin-2 family (R-HSA-5621480)
  O-linked glycosylation of mucins (R-HSA-913709)
  Termination of O-glycan biosynthesis (R-HSA-977068)
  Defective GALNT3 causes HFTC (R-HSA-5083625)

Molecular Interaction Atlas (MIA) of This DOT

7 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[1]
Breast cancer	DIS7DPX1	Strong	Biomarker	[2]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[2]
Esophageal adenocarcinoma	DISODWFP	Strong	Biomarker	[3]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Altered Expression	[3]
Neoplasm	DISZKGEW	Strong	Altered Expression	[4]
Breast neoplasm	DISNGJLM	Limited	Altered Expression	[2]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Mucin-like protein 1 (MUCL1).	[5]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Mucin-like protein 1 (MUCL1).	[6]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Mucin-like protein 1 (MUCL1).	[8]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Mucin-like protein 1 (MUCL1).	[7]

References

• [1] In silico and in vitro analysis of small breast epithelial mucin as a marker for bone marrow micrometastasis in breast cancer.Adv Exp Med Biol. 2008;617:331-9. doi: 10.1007/978-0-387-69080-3_31.
• [2] HER2 drives Mucin-like 1 to control proliferation in breast cancer cells.Oncogene. 2016 Aug 11;35(32):4225-34. doi: 10.1038/onc.2015.487. Epub 2016 Jan 4.
• [3] Accurate discrimination of Barrett's esophagus and esophageal adenocarcinoma using a quantitative three-tiered algorithm and multimarker real-time reverse transcription-PCR.Clin Cancer Res. 2005 Mar 15;11(6):2205-14. doi: 10.1158/1078-0432.CCR-04-1091.
• [4] Small breast epithelial mucin (SBEM) has the potential to be a marker for predicting hematogenous micrometastasis and response to neoadjuvant chemotherapy in breast cancer.Clin Exp Metastasis. 2010 Apr;27(4):251-9. doi: 10.1007/s10585-010-9323-2. Epub 2010 Apr 3.
• [5] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [6] Persistent and non-persistent changes in gene expression result from long-term estrogen exposure of MCF-7 breast cancer cells. J Steroid Biochem Mol Biol. 2011 Feb;123(3-5):140-50.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [8] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.