Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT9ZJR3N)

• DOT Name: Retrotransposon Gag-like protein 5 (RTL5)
• Synonyms: Retrotransposon gag domain-containing protein 4
• Gene Name: RTL5
• Related Disease: Neoplasm
• UniProt ID: RTL5_HUMAN
• Pfam ID: PF16297
• Sequence:
  MSEASGNLNSLRMANVALREELNALRGENANLGLQLGRALAEVNSLRGNVSSYIRWPVPI
  VPVLAEENLEFALSEIEVIPGGELPFLCRPPPRAEPDCISDDLLINVIQDRSTPDGPADP
  PLLPIPPPPALPPPASKEPPPQPPLAPLERPEIEPFSGDPVYLAEFLMQLETFIADHEVH
  FPGGAERVAFLISFFTGEAKDWAISVTQEGSPLHANFPRFLDEIRKEFCGPIPPRVAKKA
  IRKLKQGHCTLGSYADAFQFLAQFLSWDDCRLQNQFLKGLSEFFRKELLWSTEMADLDEL
  ILECVEIERKVRVPKPIPLPGVRNIIFPFAPSPNEEESEDEEYYSEDEDQEARRHRLHSK
  DQRKRMRAFQQEMKEKEEEEMKKEEEMKKKEEKEEEEEEEMKQKEEEEEIRNKNEEEGES
  KDEEDEDEDGGQKPEGEPQQDPGTEETYGEVEEEPLDEAQDDDLDELMEMEPTFVHASSQ
  TSGPTSGYHAENFLGASPPIIQPSRRRNQNRVPLLEGLPGTNSPFYSSPQLIRRTGRLGQ
  RQVRRRPPVLFRLTPRQGGHRAARGRIRV

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Neoplasm	DISZKGEW	Limited	Genetic Variation	[1]

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Retrotransposon Gag-like protein 5 (RTL5).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Retrotransposon Gag-like protein 5 (RTL5).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Retrotransposon Gag-like protein 5 (RTL5).	[4]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Retrotransposon Gag-like protein 5 (RTL5).	[5]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Retrotransposon Gag-like protein 5 (RTL5).	[6]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol decreases the expression of Retrotransposon Gag-like protein 5 (RTL5).	[7]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Retrotransposon Gag-like protein 5 (RTL5).	[8]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Retrotransposon Gag-like protein 5 (RTL5).	[9]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Retrotransposon Gag-like protein 5 (RTL5).	[10]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Retrotransposon Gag-like protein 5 (RTL5).	[11]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Retrotransposon Gag-like protein 5 (RTL5).	[12]

References

• [1] Dedifferentiated chondrosarcoma with t(9;22)(q34;q11-12).Genes Chromosomes Cancer. 1994 Feb;9(2):136-40. doi: 10.1002/gcc.2870090210.
• [2] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [3] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [4] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [5] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [6] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [7] The genomic response of a human uterine endometrial adenocarcinoma cell line to 17alpha-ethynyl estradiol. Toxicol Sci. 2009 Jan;107(1):40-55.
• [8] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [9] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [10] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [11] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [12] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.