Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTAFSWG1)

DOT Name Cartilage intermediate layer protein 2 (CILP2)
Synonyms CILP-2
Gene Name CILP2
Related Disease
Cardiovascular disease ( )
Clubfoot ( )
Non-alcoholic fatty liver disease ( )
Osteoarthritis ( )
Obesity ( )
Prediabetes syndrome ( )
Type-1/2 diabetes ( )
Bone osteosarcoma ( )
Non-insulin dependent diabetes ( )
Osteosarcoma ( )
UniProt ID
CILP2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF13620 ; PF13927 ; PF13330 ; PF00090
Sequence
MASLLPLLCLCVVAAHLAGARDATPTEEPMATALGLERRSVYTGQPSPALEDWEEASEWT
SWFNVDHPGGDGDFESLAAIRFYYGPARVCPRPLALEARTTDWALPSAVGERVHLNPTRG
FWCLNREQPRGRRCSNYHVRFRCPLEASWGAWGPWGPCSGSCGPGRRLRRRHCPSPAGDA
CPGRPLEAQKCVRPRCPGCSLDTCECPDHILLGSVVTPSGQPLLGARVSLRDQPGTVATS
DAHGTFRVPGVCADSRANIRAQMDGFSAGEAQAQANGSISVVTIILDKLEKPYLVKHPES
RVREAGQNVTFCCKASGTPMPKKYSWFHNGTLLDRRAHGYGAHLELRGLRPDQAGIYHCK
AWNEAGAVRSGTARLTVLAPGQPACDPRPREYLIKLPEDCGQPGSGPAYLDVGLCPDTRC
PSLAGSSPRCGDASSRCCSVRRLERREIHCPGYVLPVKVVAECGCQKCLPPRGLVRGRVV
AADSGEPLRFARILLGQEPIGFTAYQGDFTIEVPPSTQRLVVTFVDPSGEFMDAVRVLPF
DPRGAGVYHEVKAMRKKAPVILHTSQSNTIPLGELEDEAPLGELVLPSGAFRRADGKPYS
GPVEARVTFVDPRDLTSAASAPSDLRFVDSDGELAPLRTYGMFSVDLRAPGSAEQLQVGP
VAVRVAASQIHMPGHVEALKLWSLNPETGLWEEESGFRREGSSGPRVRREERVFLVGNVE
IRERRLFNLDVPERRRCFVKVRAYANDKFTPSEQVEGVVVTLVNLEPAPGFSANPRAWGR
FDSAVTGPNGACLPAFCDADRPDAYTALVTATLGGEELEPAPSLPRPLPATVGVTQPYLD
RLGYRRTDHDDPAFKRNGFRINLAKPRPGDPAEANGPVYPWRSLRECQGAPVTASHFRFA
RVEADKYEYNVVPFREGTPASWTGDLLAWWPNPQEFRACFLKVKIQGPQEYMVRSHNAGG
SHPRTRGQLYGLRDARSVRDPERPGTSAACVEFKCSGMLFDQRQVDRTLVTIMPQGSCRR
VAVNGLLRDYLTRHPPPVPAEDPAAFSMLAPLDPLGHNYGVYTVTDQSPRLAKEIAIGRC
FDGSSDGFSREMKADAGTAVTFQCREPPAGRPSLFQRLLESPATALGDIRREMSEAAQAQ
ARASGPLRTRRGRVRQ
Function May play a role in cartilage scaffolding.
Tissue Specificity Expressed in articular chondrocytes but not in knee meniscal cartilage cells . Localizes to the intermediate to deep zone of articular cartilage .

Molecular Interaction Atlas (MIA) of This DOT

10 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Cardiovascular disease DIS2IQDX Strong Genetic Variation [1]
Clubfoot DISLXT4S Strong Biomarker [2]
Non-alcoholic fatty liver disease DISDG1NL Strong Genetic Variation [3]
Osteoarthritis DIS05URM Strong Altered Expression [4]
Obesity DIS47Y1K moderate Altered Expression [5]
Prediabetes syndrome DISH2I53 moderate Altered Expression [5]
Type-1/2 diabetes DISIUHAP moderate Altered Expression [5]
Bone osteosarcoma DIST1004 Limited Genetic Variation [6]
Non-insulin dependent diabetes DISK1O5Z Limited Altered Expression [5]
Osteosarcoma DISLQ7E2 Limited Genetic Variation [6]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Cartilage intermediate layer protein 2 (CILP2). [7]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Cartilage intermediate layer protein 2 (CILP2). [13]
------------------------------------------------------------------------------------
6 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Cartilage intermediate layer protein 2 (CILP2). [8]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Cartilage intermediate layer protein 2 (CILP2). [9]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Cartilage intermediate layer protein 2 (CILP2). [10]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Cartilage intermediate layer protein 2 (CILP2). [11]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Cartilage intermediate layer protein 2 (CILP2). [12]
Sulforaphane DMQY3L0 Investigative Sulforaphane increases the expression of Cartilage intermediate layer protein 2 (CILP2). [14]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)

References

1 Association of CILP2 and ACE gene polymorphisms with cardiovascular risk factors in Slovak midlife women.Biomed Res Int. 2013;2013:634207. doi: 10.1155/2013/634207. Epub 2013 Nov 20.
2 Novel contribution to clubfoot pathogenesis: The possible role of extracellular matrix proteins.J Orthop Res. 2019 Mar;37(3):769-778. doi: 10.1002/jor.24211. Epub 2019 Feb 12.
3 Replication analysis of genetic association of the NCAN-CILP2 region with plasma lipid levels and non-alcoholic fatty liver disease in Asian and Pacific ethnic groups.Lipids Health Dis. 2016 Jan 13;15:8. doi: 10.1186/s12944-016-0181-z.
4 Cartilage intermediate layer protein 2 (CILP-2) is expressed in articular and meniscal cartilage and down-regulated in experimental osteoarthritis.J Biol Chem. 2011 Oct 28;286(43):37758-67. doi: 10.1074/jbc.M111.248039. Epub 2011 Aug 31.
5 CILP-2 is a novel secreted protein and associated with insulin resistance.J Mol Cell Biol. 2019 Dec 19;11(12):1083-1094. doi: 10.1093/jmcb/mjz016.
6 Genetic determinants of childhood and adult height associated with osteosarcoma risk.Cancer. 2018 Sep 15;124(18):3742-3752. doi: 10.1002/cncr.31645. Epub 2018 Oct 12.
7 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
8 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
9 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
10 Research resource: STR DNA profile and gene expression comparisons of human BG-1 cells and a BG-1/MCF-7 clonal variant. Mol Endocrinol. 2014 Dec;28(12):2072-81.
11 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
12 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
13 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
14 Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.