Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTBFIOVY)

• DOT Name: Solute carrier family 2, facilitated glucose transporter member 14 (SLC2A14)
• Synonyms: Glucose transporter type 14; GLUT-14
• Gene Name: SLC2A14
• UniProt ID: GTR14_HUMAN
• Pfam ID: PF00083
• Sequence:
  MEFHNGGHVSGIGGFLVSLTSRMKPHTLAVTPALIFAITVATIGSFQFGYNTGVINAPET
  IIKEFINKTLTDKANAPPSEVLLTNLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLI
  VNLLAATGGCLMGLCKIAESVEMLILGRLVIGLFCGLCTGFVPMYIGEISPTALRGAFGT
  LNQLGIVIGILVAQIFGLELILGSEELWPVLLGFTILPAILQSAALPCCPESPRFLLINR
  KKEENATRILQRLWGTQDVSQDIQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVL
  QLSQQLSGINAVFYYSTGIFKDAGVQQPIYATISAGVVNTIFTLLSLFLVERAGRRTLHM
  IGLGGMAFCSTLMTVSLLLKNHYNGMSFVCIGAILVFVACFEIGPGPIPWFIVAELFSQG
  PRPAAMAVAGCSNWTSNFLVGLLFPSAAYYLGAYVFIIFTGFLITFLAFTFFKVPETRGR
  TFEDITRAFEGQAHGADRSGKDGVMGMNSIEPAKETTTNV
• Function: Hexose transporter that can mediate the transport of glucose and dehydroascorbate across the cell membrane.
• Tissue Specificity: Mainly expressed in testis . Also expressed in small intestine, liver and kidney .
• Reactome Pathway: Cellular hexose transport (R-HSA-189200)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Fluorouracil	DMUM7HZ	Approved	Solute carrier family 2, facilitated glucose transporter member 14 (SLC2A14) affects the response to substance of Fluorouracil.	[19]

17 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Solute carrier family 2, facilitated glucose transporter member 14 (SLC2A14).	[1]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Solute carrier family 2, facilitated glucose transporter member 14 (SLC2A14).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin affects the expression of Solute carrier family 2, facilitated glucose transporter member 14 (SLC2A14).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Solute carrier family 2, facilitated glucose transporter member 14 (SLC2A14).	[4]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Solute carrier family 2, facilitated glucose transporter member 14 (SLC2A14).	[5]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Solute carrier family 2, facilitated glucose transporter member 14 (SLC2A14).	[6]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Solute carrier family 2, facilitated glucose transporter member 14 (SLC2A14).	[7]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Solute carrier family 2, facilitated glucose transporter member 14 (SLC2A14).	[8]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of Solute carrier family 2, facilitated glucose transporter member 14 (SLC2A14).	[9]
Gemcitabine	DMSE3I7	Approved	Gemcitabine increases the expression of Solute carrier family 2, facilitated glucose transporter member 14 (SLC2A14).	[10]
Zidovudine	DM4KI7O	Approved	Zidovudine decreases the expression of Solute carrier family 2, facilitated glucose transporter member 14 (SLC2A14).	[11]
Cholecalciferol	DMGU74E	Approved	Cholecalciferol affects the expression of Solute carrier family 2, facilitated glucose transporter member 14 (SLC2A14).	[12]
Vandetanib	DMRICNP	Approved	Vandetanib increases the expression of Solute carrier family 2, facilitated glucose transporter member 14 (SLC2A14).	[13]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Solute carrier family 2, facilitated glucose transporter member 14 (SLC2A14).	[14]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Solute carrier family 2, facilitated glucose transporter member 14 (SLC2A14).	[15]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Solute carrier family 2, facilitated glucose transporter member 14 (SLC2A14).	[16]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Solute carrier family 2, facilitated glucose transporter member 14 (SLC2A14).	[17]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Solute carrier family 2, facilitated glucose transporter member 14 (SLC2A14).	[18]

References

• [1] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [2] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [3] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [4] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [5] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [6] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [7] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [8] Cannabidiol induces antioxidant pathways in keratinocytes by targeting BACH1. Redox Biol. 2020 Jan;28:101321. doi: 10.1016/j.redox.2019.101321. Epub 2019 Sep 5.
• [9] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [10] Gene expression profiling of breast cancer cells in response to gemcitabine: NF-kappaB pathway activation as a potential mechanism of resistance. Breast Cancer Res Treat. 2007 Apr;102(2):157-72.
• [11] Differential gene expression in human hepatocyte cell lines exposed to the antiretroviral agent zidovudine. Arch Toxicol. 2014 Mar;88(3):609-23. doi: 10.1007/s00204-013-1169-3. Epub 2013 Nov 30.
• [12] Targeting iron homeostasis induces cellular differentiation and synergizes with differentiating agents in acute myeloid leukemia. J Exp Med. 2010 Apr 12;207(4):731-50. doi: 10.1084/jem.20091488. Epub 2010 Apr 5.
• [13] ZD6474 inhibits tumor growth and intraperitoneal dissemination in a highly metastatic orthotopic gastric cancer model. Int J Cancer. 2006 Jan 15;118(2):483-9. doi: 10.1002/ijc.21340.
• [14] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [15] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [16] New insights into BaP-induced toxicity: role of major metabolites in transcriptomics and contribution to hepatocarcinogenesis. Arch Toxicol. 2016 Jun;90(6):1449-58.
• [17] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [18] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [19] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.