Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTBISJZQ)

DOT Name Transmembrane 9 superfamily member 3 (TM9SF3)
Synonyms EP70-P-iso; SM-11044-binding protein
Gene Name TM9SF3
Related Disease
Neoplasm ( )
Adult T-cell leukemia/lymphoma ( )
Gastric cancer ( )
Stomach cancer ( )
UniProt ID
TM9S3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF02990
Sequence
MRPLPGALGVAAAAALWLLLLLLPRTRADEHEHTYQDKEEVVLWMNTVGPYHNRQETYKY
FSLPFCVGSKKSISHYHETLGEALQGVELEFSGLDIKFKDDVMPATYCEIDLDKEKRDAF
VYAIKNHYWYQMYIDDLPIWGIVGEADENGEDYYLWTYKKLEIGFNGNRIVDVNLTSEGK
VKLVPNTKIQMSYSVKWKKSDVKFEDRFDKYLDPSFFQHRIHWFSIFNSFMMVIFLVGLV
SMILMRTLRKDYARYSKEEEMDDMDRDLGDEYGWKQVHGDVFRPSSHPLIFSSLIGSGCQ
IFAVSLIVIIVAMIEDLYTERGSMLSTAIFVYAATSPVNGYFGGSLYARQGGRRWIKQMF
IGAFLIPAMVCGTAFFINFIAIYYHASRAIPFGTMVAVCCICFFVILPLNLVGTILGRNL
SGQPNFPCRVNAVPRPIPEKKWFMEPAVIVCLGGILPFGSIFIEMYFIFTSFWAYKIYYV
YGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYYYFFK
TKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Neoplasm DISZKGEW Definitive Altered Expression [1]
Adult T-cell leukemia/lymphoma DIS882XU Strong Biomarker [2]
Gastric cancer DISXGOUK Strong Altered Expression [3]
Stomach cancer DISKIJSX Strong Altered Expression [3]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Transmembrane 9 superfamily member 3 (TM9SF3). [4]
------------------------------------------------------------------------------------
7 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Transmembrane 9 superfamily member 3 (TM9SF3). [5]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Transmembrane 9 superfamily member 3 (TM9SF3). [6]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Transmembrane 9 superfamily member 3 (TM9SF3). [7]
Demecolcine DMCZQGK Approved Demecolcine decreases the expression of Transmembrane 9 superfamily member 3 (TM9SF3). [8]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Transmembrane 9 superfamily member 3 (TM9SF3). [9]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Transmembrane 9 superfamily member 3 (TM9SF3). [8]
Deguelin DMXT7WG Investigative Deguelin decreases the expression of Transmembrane 9 superfamily member 3 (TM9SF3). [10]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Drug(s)

References

1 Identification of novel transmembrane proteins in scirrhous-type gastric cancer by the Escherichia coli ampicillin secretion trap (CAST) method: TM9SF3 participates in tumor invasion and serves as a prognostic factor.Pathobiology. 2014;81(3):138-48. doi: 10.1159/000357821. Epub 2014 Mar 8.
2 miR-1193 Suppresses the Proliferation and Invasion of Human T-Cell Leukemia Cells Through Directly Targeting the Transmembrane 9 Superfamily 3 (TM9SF3).Oncol Res. 2017 Nov 2;25(9):1643-1651. doi: 10.3727/096504017X14908284471361. Epub 2017 Mar 30.
3 Clinicopathologic and molecular characteristics of gastric cancer showing gastric and intestinal mucin phenotype.Cancer Sci. 2015 Aug;106(8):951-8. doi: 10.1111/cas.12706. Epub 2015 Jul 7.
4 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
5 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
6 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
7 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
8 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
9 Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.
10 Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.