| DOT Name |
Glutathione S-transferase theta-2B (GSTT2B)
|
| Synonyms |
EC 2.5.1.18; Glutathione S-transferase theta-2; GST class-theta-2 |
| Gene Name |
GSTT2B
|
| Related Disease |
- Advanced cancer ( )
- Allergic rhinitis ( )
- Alzheimer disease ( )
- Asthma ( )
- Charcot marie tooth disease ( )
- Essential hypertension ( )
- Hypothyroidism ( )
- Schizophrenia ( )
|
| UniProt ID |
|
| 3D Structure |
|
| PDB ID |
|
| EC Number |
|
| Pfam ID |
|
| Sequence |
MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDG DFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLG PLIGVQVPEEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALG YELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRI ARIP
|
| Function |
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Has a sulfatase activity. |
| Tissue Specificity |
Expressed at low levels in liver. In lung, expressed at low levels in ciliated bronchiolar cells, alveolar macrophages and alveolar type II cells. |
| KEGG Pathway |
- Glutathione metabolism (hsa00480 )
- Metabolism of xenobiotics by cytochrome P450 (hsa00980 )
- Drug metabolism - cytochrome P450 (hsa00982 )
- Drug metabolism - other enzymes (hsa00983 )
- Metabolic pathways (hsa01100 )
- Platinum drug resistance (hsa01524 )
- Pathways in cancer (hsa05200 )
- Chemical carcinogenesis - D. adducts (hsa05204 )
- Chemical carcinogenesis - receptor activation (hsa05207 )
- Chemical carcinogenesis - reactive oxygen species (hsa05208 )
- Hepatocellular carcinoma (hsa05225 )
- Fluid shear stress and atherosclerosis (hsa05418 )
|
| Reactome Pathway |
- Glutathione conjugation (R-HSA-156590 )
|
|
|
|
|
|
|