General Information of Drug Off-Target (DOT) (ID: OTCOHLXR)

DOT Name Neutrophil elastase (ELANE)
Synonyms EC 3.4.21.37; Bone marrow serine protease; Elastase-2; Human leukocyte elastase; HLE; Medullasin; PMN elastase
Gene Name ELANE
Related Disease
Neutropenia ( )
Cyclic hematopoiesis ( )
Autosomal dominant severe congenital neutropenia ( )
UniProt ID
ELNE_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1B0F; 1H1B; 1HNE; 1PPF; 1PPG; 2RG3; 2Z7F; 3Q76; 3Q77; 4NZL; 4WVP; 5A09; 5A0A; 5A0B; 5A0C; 5A8X; 5A8Y; 5A8Z; 5ABW; 6E69; 6F5M; 6SMA; 7CBK; 7WHU; 8D4Q; 8D4U; 8D7I; 8D7K; 8G24; 8G25; 8G26
EC Number
3.4.21.37
Pfam ID
PF00089
Sequence
MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
Function
Serine protease that modifies the functions of natural killer cells, monocytes and granulocytes. Inhibits C5a-dependent neutrophil enzyme release and chemotaxis. Promotes cleavage of GSDMB, thereby inhibiting pyroptosis. Capable of killing E.coli but not S.aureus in vitro; digests outer membrane protein A (ompA) in E.coli and K.pneumoniae.
Tissue Specificity Bone marrow cells. Neutrophil .
KEGG Pathway
Neutrophil extracellular trap formation (hsa04613 )
Transcriptio.l misregulation in cancer (hsa05202 )
Systemic lupus erythematosus (hsa05322 )
Reactome Pathway
Degradation of the extracellular matrix (R-HSA-1474228 )
Activation of Matrix Metalloproteinases (R-HSA-1592389 )
Pyroptosis (R-HSA-5620971 )
Neutrophil degranulation (R-HSA-6798695 )
Antimicrobial peptides (R-HSA-6803157 )
Regulation of Complement cascade (R-HSA-977606 )
Collagen degradation (R-HSA-1442490 )

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Neutropenia DISGCAMX Definitive Autosomal dominant [1]
Cyclic hematopoiesis DISQQOM4 Strong Autosomal dominant [2]
Autosomal dominant severe congenital neutropenia DISZC7BV Supportive Autosomal dominant [3]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Biotransformations of 1 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Aniline DMLCAR9 Investigative Neutrophil elastase (ELANE) increases the hydrolysis of Aniline. [12]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Neutrophil elastase (ELANE). [4]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Neutrophil elastase (ELANE). [8]
------------------------------------------------------------------------------------
4 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Neutrophil elastase (ELANE). [5]
Glyceryl trinitrate DMF72W3 Phase 4 Glyceryl trinitrate increases the expression of Neutrophil elastase (ELANE). [6]
Paraquat DMR8O3X Investigative Paraquat decreases the expression of Neutrophil elastase (ELANE). [9]
KOJIC ACID DMP84CS Investigative KOJIC ACID decreases the expression of Neutrophil elastase (ELANE). [10]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT
Drug Name Drug ID Highest Status Interaction REF
Lipoteichoic acid DMEMRW0 Phase 1/2 Lipoteichoic acid increases the secretion of Neutrophil elastase (ELANE). [7]
Fmet-leu-phe DMQ391A Investigative Fmet-leu-phe increases the secretion of Neutrophil elastase (ELANE). [11]
------------------------------------------------------------------------------------

References

1 Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
2 [Evaluation of driving-ability in handicapped]. Beitr Orthop Traumatol. 1975 Feb;22(2):134-5.
3 Clinical Practice Guidelines for Rare Diseases: The Orphanet Database. PLoS One. 2017 Jan 18;12(1):e0170365. doi: 10.1371/journal.pone.0170365. eCollection 2017.
4 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
5 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
6 Cardiopulmonary bypass exacerbates oxidative stress but does not increase proinflammatory cytokine release in patients with diabetes compared with patients without diabetes: regulatory effects of exogenous nitric oxide. J Thorac Cardiovasc Surg. 2000 Jul;120(1):1-11. doi: 10.1067/mtc.2000.106835.
7 Thalidomide inhibits granulocyte responses in healthy humans after ex vivo stimulation with bacterial antigens. Antimicrob Agents Chemother. 2001 May;45(5):1547-9. doi: 10.1128/AAC.45.5.1547-1549.2001.
8 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
9 CD34+ derived macrophage and dendritic cells display differential responses to paraquat. Toxicol In Vitro. 2021 Sep;75:105198. doi: 10.1016/j.tiv.2021.105198. Epub 2021 Jun 9.
10 Toxicogenomics of kojic acid on gene expression profiling of a375 human malignant melanoma cells. Biol Pharm Bull. 2006 Apr;29(4):655-69.
11 2-(2-Fluorobenzamido)benzoate ethyl ester (EFB-1) inhibits superoxide production by human neutrophils and attenuates hemorrhagic shock-induced organ dysfunction in rats. Free Radic Biol Med. 2011 Jun 15;50(12):1737-48. doi: 10.1016/j.freeradbiomed.2011.03.026. Epub 2011 Mar 30.
12 Similarities between human and rat leukocyte elastase and cathepsin G. Eur J Biochem. 1984 Oct 1;144(1):1-9. doi: 10.1111/j.1432-1033.1984.tb08423.x.