Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTCZC9ZM)

• DOT Name: Mast cell-expressed membrane protein 1 (MCEMP1)
• Gene Name: MCEMP1
• UniProt ID: MCEM1_HUMAN
• Sequence:
  MEVEEIYKHQEVKMQAPAFRDKKQGVSAKNQGAHDPDYENITLAFKNQDHAKGGHSRPTS
  QVPAQCRPPSDSTQVPCWLYRAILSLYILLALAFVLCIILSAFIMVKNAEMSKELLGFKR
  ELWNVSNSVQACEERQKRGWDSVQQSITMVRSKIDRLETTLAGIKNIDTKVQKILEVLQK
  MPQSSPQ
• Tissue Specificity: Expressed specifically in mast cells. Found primarily in lung.
• Reactome Pathway: Neutrophil degranulation (R-HSA-6798695)

Molecular Interaction Atlas (MIA) of This DOT

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Mast cell-expressed membrane protein 1 (MCEMP1).	[1]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Mast cell-expressed membrane protein 1 (MCEMP1).	[2]
Pioglitazone	DMKJ485	Approved	Pioglitazone increases the expression of Mast cell-expressed membrane protein 1 (MCEMP1).	[3]
Cholecalciferol	DMGU74E	Approved	Cholecalciferol affects the expression of Mast cell-expressed membrane protein 1 (MCEMP1).	[4]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Mast cell-expressed membrane protein 1 (MCEMP1).	[5]

References

• [1] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [2] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [3] Peroxisome proliferator activated receptor gamma (PPAR-gama) ligand pioglitazone regulated gene networks in term human primary trophoblast cells. Reprod Toxicol. 2018 Oct;81:99-107.
• [4] Targeting iron homeostasis induces cellular differentiation and synergizes with differentiating agents in acute myeloid leukemia. J Exp Med. 2010 Apr 12;207(4):731-50. doi: 10.1084/jem.20091488. Epub 2010 Apr 5.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.